(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE265

ASFUM1_4.PE265       Location/Qualifiers
FT   CDS_pept        join(complement(1070872..1071178),
FT                   complement(1070686..1070813))
FT                   /codon_start=1
FT                   /gene_family="HOG000170953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259028"
FT                   /orf_name="AFUA_4G03830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84532.1"
FT                   /db_xref="HOGENOM:HBG054409"
FT                   /db_xref="HOGENOM:HBG327365"
FT                   /db_xref="UniParc:UPI00005201FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T1"
FT                   /transl_table=1
FT                   /translation="MRLLSTLTLLVSAVAANPMFHTARQDTSATKPFHLKTADASNEKH
FT                   NDLYVYAYHTGAGFNDAVLTPDKDTASTAFLNGTYTQFDLKTPFPWGFKPIAVTNYAQW
FT                   ESVEINVGYGAEGFFIDSTGLQWSEQQGFGGWLGKQFPCR"
     atgaggctgc tttctactct cactcttctg gtttccgcag tggcggccaa ccccatgttc        60
     catactgctc gccaggacac cagcgccacc aagcccttcc atcttaagac cgcagacgcg       120
     tccaacgaga aacacaatga tttatatgtc tacgcctacc acaccggagc aggattcaat       180
     gacgctgtcc tcacgcccga taaggatact gccagtacgg cgttcctgaa cggcacatac       240
     acccagttcg acttgaagac tccattccct tggggcttca agccgatcgc tgttaccaac       300
     tatgcccaat gggagtccgt ggagattaat gtcggctatg gcgcggaggg attcttcatc       360
     gatagcaccg gcctgcagtg gtcagagcaa cagggctttg gcggctggct gggtaagcaa       420
     tttccctgcc ggtaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page