(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE267

ASFUM1_4.PE267       Location/Qualifiers
FT   CDS_pept        join(1078016..1078568,1078629..1078900,1078952..1079151,
FT                   1079217..1079376,1079427..1079686,1079744..1079863,
FT                   1079911..1080269,1080321..1081081)
FT                   /codon_start=1
FT                   /gene_family="HOG000170931" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259030"
FT                   /orf_name="AFUA_4G03850"
FT                   /product="Protein kinase Yak1, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL84534.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG191920"
FT                   /db_xref="HOGENOM:HBG327364"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051EA59"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S9"
FT                   /transl_table=1
FT                   /translation="MGSQWQPYQDPLMGRPAQFNNGLASTPQQLGPKYGGQPQQSQPPV
FT                   GYTYEAFQTPGTAAKPPSAGANSKSVSMASSPAATPRSRDYVTDADTTMEDADPYNRAK
FT                   YSARPNHHSRPSSQFFSPEESSAARRYSPMNVLSPSMSYNTSPGKSQNSYAFPPGPNNS
FT                   RRSPTRALNYSSPAQSFQSPPSVSRPPRLPPLQPTEMSSDQFYPPSAGSQVNAHFGQDG
FT                   RSPRSGSISGASKQAGRGPVPKFQKIKSVQELQPRINAQPPYRRANPEGGFISPLQALT
FT                   SHLPATYRICNPSFNYESSRNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAG
FT                   HKNRYLILDVLGQGTFGQVVKCQNLKTQEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSK
FT                   YDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLN
FT                   ALSLLNKAHLIHCDLKPENILLKNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEV
FT                   LLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQS
FT                   GEFFEKTQDEFGRKTYRLKSLEQYSREHNTKEQPSKKYFQASTLEEIIRSYPMPRKNMK
FT                   QAEIERELNNRVAFIDFVRGLLSINPLERWSPQQAKLHPFITQQKFTGPFVPPMNLKYS
FT                   SLNKTIPPGIQQQQQAEAASKQRAAQAAHAQSAAQNAYSMQMNQFHTPSHGQPPPMYNG
FT                   MFAGHQQGAPPPYPAQPPGYGHQMNLMPGQMPQSQYAPSQSLYAQATTRAGRQRASTMD
FT                   HQGGGIPPTIQRVASHLDPNAPIRLQPSPAYYPPPPDGYVDNNAQRRRGSRAGAGQRNR
FT                   DFIRTLEDGVLGGDGYMNQSQWH"
     atgggttctc agtggcagcc gtaccaggac cccttgatgg gacgtcctgc gcagttcaat        60
     aatggattgg cgtctactcc tcaacaatta ggccctaagt atggtggtca gccacagcag       120
     tctcagccgc ccgtgggata tacctatgaa gccttccaaa cgcccggaac agcagcgaaa       180
     cctccttcgg ccggcgcaaa ctccaaatcg gtatctatgg cgtcgtcacc agccgcaacg       240
     ccacgtagcc gcgattatgt caccgatgcc gataccacca tggaggatgc ggacccgtac       300
     aacagggcga agtactctgc gcgaccgaat catcatagtc gaccctcgtc tcaatttttc       360
     tctcctgagg agtcctcggc cgcccgaagg tactccccga tgaatgttct gtcaccgtcc       420
     atgtcttaca atactagtcc tggaaagtct cagaactcat acgctttccc acccggacca       480
     aacaactctc gccggtcgcc gaccagagct ctgaactact cctcacccgc tcagtcattt       540
     cagtcgcctc cctctgtgtc acgtcctcct cggctccctc cgctacagcc taccgagatg       600
     agttccgacc aattctaccc gccttcagca ggatcccaag tcaacgctca ctttggacaa       660
     gatggcagat cgccccggtc gggatccatc tcgggtgcga gtaagcaagc cggccgaggg       720
     ccagtgccga agtttcaaaa gatcaagtcg gtccaggagc tccaacctcg cattaatgcg       780
     cagcctccat atagacgtgc caatccagaa ggtggcttca ttagtcccct tcaagcgtta       840
     acctcccatc ttccggccac ataccgtatc tgcaatccaa gcttcaatta cgagtcttcg       900
     cggaatccca gacgtgtcct aacgaaacca agcaagggag tcaaaaacga cggctatgac       960
     aatgaggaca gcgattatat tctctatgtg aacgacattc ttggaagcga agaagcgggt      1020
     cacaagaatc gttacctcat tctcgacgtg ttgggccagg ggacgtttgg tcaagtcgtc      1080
     aagtgccaaa atctgaaaac ccaagaggtt gttgccgtga aggtcattaa gaataagact      1140
     gcatacttta atcagagtat gatggaagtc tcggttttgg acttgcttaa cagcaagtac      1200
     gacaagaacg acgaccatca cctgcttcgt ttgaaggata cttttatcca ccggcagcat      1260
     ctctgtctgg tttttgaatt gctcagtgtc aatctttatg aattgatcaa gcaaaaccag      1320
     tttcgtggtt tgagcacaac tctcgtccgt gtttttgctc agcaacttct caacgcgttg      1380
     agtctgttaa acaaggcgca tctaattcat tgtgatctca agcccgagaa catattactg      1440
     aagaatcttg agagtccaat tatcaaagtc atcgatttcg gctctgcttg cgatgagcga      1500
     caaactgtct acacgtatat ccagtcgaga ttctaccgtt cccccgaggt gctgcttggc      1560
     ttaccttact cgtctgcaat cgatatgtgg tctcttggtt gcatcgttgt cgagctcttc      1620
     cttggtctgc ctcttttccc tggctcctcc gaatacaatc aggtctgtcg gattgtggaa      1680
     atgcttggtc taccaccgac gtggatgctt gaaatgggca agcagtcagg tgaattcttt      1740
     gagaagaccc aggacgagtt cggtcgcaag acataccggc tgaaaagcct ggaacaatac      1800
     tcccgcgaac ataacacgaa agaacaaccg agcaaaaagt atttccaggc ttccacgctg      1860
     gaagaaatca ttcggagcta tccaatgcct aggaagaata tgaagcaagc cgagatcgag      1920
     cgagaattga acaatcgagt tgctttcatc gactttgttc gtggactgct gtcaatcaac      1980
     cctcttgagc gatggtcgcc ccaacaagcc aagctgcacc ctttcattac gcagcagaag      2040
     tttacagggc ccttcgtacc gccaatgaat ctgaaatatt cctcgctcaa caaaaccata      2100
     ccgcctggaa tacagcagca acagcaggct gaggctgcta gcaaacagcg agctgcccaa      2160
     gcggcacatg ctcagtcagc ggcccagaat gcatattcga tgcaaatgaa tcagttccat      2220
     acaccttctc atggccaacc cccacccatg tacaacggca tgtttgccgg ccatcagcaa      2280
     ggcgctcctc ctccatatcc tgcccagccg cctggctacg gccatcaaat gaaccttatg      2340
     ccaggtcaga tgcctcaatc gcaatatgca ccgtctcaga gtctctacgc tcaagcaacc      2400
     actagagctg gtcgccaacg cgcatccacc atggaccatc agggaggagg aattccgcca      2460
     actattcaac gcgttgccag tcacctggac ccgaatgccc ccattcgact ccagcccagc      2520
     ccagcgtatt acccgccacc tcctgacgga tatgtcgaca acaatgctca acggcgcagg      2580
     ggaagccgtg caggggctgg tcaacgtaac cgagacttca ttcggactct cgaggacggt      2640
     gtcctcggcg gcgacggcta tatgaaccag agccagtggc actga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page