(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE268

ASFUM1_4.PE268       Location/Qualifiers
FT   CDS_pept        join(1082663..1082999,1083094..1085345)
FT                   /codon_start=1
FT                   /gene_family="HOG000029414" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206313"
FT                   /gene_name="nip1"
FT                   /orf_name="AFUA_4G03860"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit C"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 3 complex"
FT                   /protein_id="EAL84535.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005852"
FT                   /db_xref="HOGENOM:HBG354580"
FT                   /db_xref="HOGENOM:HBG608917"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000051E804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W9S8"
FT                   /transl_table=1
FT                   /translation="MSSRFFYGGGSDSDSSSSDEEELYSDREEEEKSEEEESSEEEDET
FT                   SEEEESDEETGARKFLKDVASDSEEEEEEEKVTVVKSAKDKRLDELENTIKLIENAKKI
FT                   NDWAVISTEFDKLNRQVAKITQSGPTPKIYIKAVADLEDFVNETVAKQKSGDKKLNASQ
FT                   AKGFNAAKQRIKKNNKDYGNLIDKYRKDKEDFMESDDEEAIPVIAAPRITKLERIEAPA
FT                   AAIDDDGFATVGRGGKTLQYTPESILKHLRVIVESRGKKNTDRMEQIRTMEKLLEVAQT
FT                   PYQRIRVYLTLISTRFDLTSTSSANYMAVDQWKSAEQDFSSLLSVLENNRDHVVFEGAE
FT                   EWEDDEKQPTIAPGETLYIPGSIVSFAERLDDELTRSLQHIDPHTAEYIERLSDEKLLY
FT                   TDLVRAQAYVEGLNEVEKTDPRQDSVNRVVMRRLEHVYFKPSQVITILEDATWKSLPSE
FT                   LDSSITPRASSGNVENLVLSLCNYLFKYSDGIIRARAMLCQIYFLALHDQYYRSRDLML
FT                   MSHLTENISNFDVSTQILFNRTLVQIGLCAFRSGLIYEAQNTLSEVCGSGRQKELLAQG
FT                   IIMQRYSTVSPEQERLERQRQLPFHMHINLELLECIYLTSSMFLEVPLMAQTSSSPEMK
FT                   RRVISKTFRRMLDYNERQVFTGPPENTRDGVIMSAKFLAAGDWKKAAEMLNSIKIWDLM
FT                   PQPDKIKEMLSQQIQEEGLRTYLFTYAPFYDSLSIATLSNMFELSEKKISAIISRMISH
FT                   EELAAALDQVNNAIVFRKGVELSRLQSQIVTLADKSMNLLEANEKTLEQRTQGMANAFQ
FT                   RDQGAGARGGRGSGRGGQARGGPRFPGGQQGRRPGGQQFGGGALGGAIKA"
     atgtcgtcgc gtttctttta cggcggtggt agcgacagcg actccagctc gtctgacgag        60
     gaggagcttt acagcgatcg cgaggaggag gaaaagtccg aggaggaaga atccagcgag       120
     gaggaagatg agacctcgga ggaggaggag tccgacgagg aaacaggtgc aaggaagttc       180
     ttgaaggatg ttgcttccga cagcgaggaa gaggaagagg aggagaaagt cacggttgtc       240
     aagagtgcca aggataagag attggatgag cttgagaaca ctatcaagct gattgagaac       300
     gccaagaaga ttaacgactg ggctgttatc tcgacagagt tcgacaagct gaaccgacag       360
     gttgcaaaga tcacgcaatc tggtccaact cccaagattt acatcaaagc cgttgccgac       420
     cttgaggatt tcgtgaacga aactgttgcc aagcagaagt ctggagataa gaagctgaac       480
     gctagccagg ccaagggctt caacgctgcc aagcagcgta tcaagaagaa taacaaggac       540
     tatggcaacc tgatcgacaa gtaccggaag gacaaggagg actttatgga aagtgacgat       600
     gaggaggcca tccccgttat tgctgctccc cgcatcacca agttggagcg tattgaggcg       660
     cccgccgctg ccatcgatga tgatggcttc gcaaccgttg gccgcggtgg caagactctg       720
     cagtacaccc ctgagagcat cctgaagcac ctccgtgtga tcgtcgagtc gcgaggaaag       780
     aagaacacag accgtatgga gcagattcgg acgatggaga agcttctgga ggtggctcag       840
     actccttatc agcgcatccg tgtttacctt actctcattt ccacgcgttt cgatctcaca       900
     tccacgtcca gtgccaacta catggccgtc gatcagtgga agtccgccga gcaggacttc       960
     tcgtccctgc tgtcggtttt ggagaacaac cgtgaccatg ttgtgttcga aggtgccgaa      1020
     gaatgggaag atgacgagaa gcaacccacc atcgcccccg gcgagaccct ctacatcccc      1080
     ggtagcattg tgtctttcgc cgagagactc gacgacgagc ttactagatc gctgcaacac      1140
     atcgaccccc acaccgctga gtacattgag cgcctgagtg atgagaagct gctgtacacc      1200
     gatctcgttc gcgcccaagc ctacgtcgaa ggtttgaacg aagtcgagaa gaccgatccc      1260
     agacaggaca gtgtcaaccg ggtggtcatg agacgattgg agcacgtcta cttcaagccc      1320
     tcgcaggtca tcacaatcct tgaagatgcc acatggaagt cccttccctc agagctggat      1380
     tctagcatca cccctcgggc tagcagtggc aacgtcgaga acctcgtttt gtccctgtgc      1440
     aactatctgt tcaagtacag tgatggtatc atcagagccc gcgcgatgct gtgccagatt      1500
     tacttccttg ccctgcatga ccagtactac cgctctcgtg atctgatgct catgtcccat      1560
     ctcactgaga atatttccaa ctttgacgtc agcactcaga ttctcttcaa tcgaacgctg      1620
     gtgcaaatcg gtctttgcgc cttccgctcc ggtctcatct acgaagctca gaacaccctt      1680
     tctgaagttt gcggcagtgg acgtcaaaag gagctcctgg cccagggtat cattatgcag      1740
     cgctactcca cggtatcccc ggagcaggag cgtcttgagc gtcagcgcca gctgccgttc      1800
     cacatgcaca tcaacctgga gctgcttgag tgcatctacc tcacctccag catgttcctg      1860
     gaagttcctc tgatggccca gacttcctct tctcccgaga tgaagcgccg tgtcatttcc      1920
     aagaccttcc gccgtatgtt ggattacaat gagcgccaag tcttcactgg tcccccggag      1980
     aacactcgtg acggcgtgat catgagcgct aagttccttg ccgctggtga ctggaagaag      2040
     gctgctgaga tgctcaactc aatcaagatt tgggatctga tgccccagcc cgacaagatc      2100
     aaggagatgc tttcccagca gatccaggag gagggcctga gaacctacct tttcacttac      2160
     gctcctttct acgacagcct ctccatcgcc accctctcca acatgttcga gctttctgag      2220
     aagaagatct ccgccatcat cagtcgtatg atctcgcacg aagagctggc agctgctctg      2280
     gatcaggtca acaacgccat cgtcttccgc aagggcgtcg agttgtcgcg cctccagtcc      2340
     cagatcgtca cgctggccga taagtccatg aaccttctgg aagccaacga gaagactctc      2400
     gagcagcgca cccaaggcat ggccaacgcc ttccagcgcg atcagggcgc cggcgcccgt      2460
     ggtggccgtg gatccggacg cggtggtcag gcccgcggtg gccccagatt tcccggtggc      2520
     cagcaaggcc gtcggcccgg tggacagcaa tttggtggtg gtgcattggg cggagctatc      2580
     aaggcttaa                                                              2589
//

If you have problems or comments...

PBIL Back to PBIL home page