(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE272

ASFUM1_4.PE272       Location/Qualifiers
FT   CDS_pept        join(1091411..1091566,1091631..1091858,1091924..1092032,
FT                   1092081..1092170,1092228..1092615,1092670..1093078,
FT                   1093140..1094459)
FT                   /codon_start=1
FT                   /gene_family="HOG000170895" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259033"
FT                   /orf_name="AFUA_4G03900"
FT                   /product="Peroxisomal multifunctional beta-oxidation
FT                   protein (MFP), putative"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84539.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG037639"
FT                   /db_xref="HOGENOM:HBG327812"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051F407"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9S4"
FT                   /transl_table=1
FT                   /translation="MSELRFDNQTVVVTGAGGGLGKAYATFFASRGANVVVNDLGVSHS
FT                   GEGASSKAADVVVEEIRAAGGKAVANYDSVENGEAIIETAIKNFGRIDVLINNAGILRD
FT                   VSFKNMKDQDWDLINKVHTYGAYKCARAAWPHFRKQKYGRIINTASAAGLFGNFGQANY
FT                   SAAKLGQVGFTETLAKEGAKYNIIANVIAPIAASRMTATIMPPEVLENLKPDWVVPLVA
FT                   VLVHPSNTTESGSIFEVGGGHMAKLRWERAKGALLKTDASLTPGAIARKWKDVYDYSQP
FT                   EYPIGPADFMTLLENGMKTPSAPAGEEPDLKGKVALVTGGGNGLGRSYCLLFAKLGASV
FT                   VVNDLVDPEPVVQEIKKMGGKAVGNKASCEDGDAVVKTAIDAFGRIDILVNNAGILRDK
FT                   AFTNMNDDLWNAVINVHLRGTYKVTKAAWPHMLKQKYGRIVNTTSTSGIYGNFGQANYA
FT                   AAKLGILGFSRALAIEGAKYNIKVNTIAPNAGTNMTRTIMPEEMVQAFKPDYVAPMVAL
FT                   LCSDMCPEPSSKGLYECGSGWFSSTRWQRSGGHGFPVDVKLTPETVLKNWKQITDFDDG
FT                   RADHPQDSQAGTEKVMANMSNRSGGEGGNNILANIEKAKQATTEGTAFDYIDRDIILYN
FT                   LSVGAKRTDLPLVYENNEHFQALPTFGVIPWFNTATPWNMDDIVANFSPMMLLHGEQYM
FT                   EIRKFPIPTEAKTLTYPKLIDVVDKGKAALVVAGYTTKDAKTGEDLFYNESTVFIRGSG
FT                   GFGGSPKPTASRPKGATAAYNPPKRQPDVVIEEKTSEDQAALYRLNGDRNPLHIDPEFS
FT                   KVGGFKTPILHGLCSLGISGKHVFNKFGAFKSLKVRFAGVVLPGQTLKTEMWKEGNTVI
FT                   FQTTVVETGKPAILGAGAELLEGAKAKL"
     atgtctgagc tgcgctttga caaccagact gtcgttgtta caggagctgg tggtggtctt        60
     ggaaaggcct acgctacctt cttcgcttcc agaggtgcca atgtcgttgt aaacgatctg       120
     ggtgtttccc actccggtga gggggcgtca tcaaaggctg ctgatgtagt agttgaggag       180
     attcgagcgg ctggcggcaa ggcggtagcc aactacgaca gcgttgagaa cggtgaagcc       240
     atcattgaga cagccatcaa gaacttcggc cggatcgatg ttctcatcaa caacgccggt       300
     atcctccgtg atgtcagctt caagaacatg aaggatcagg attgggatct gatcaacaaa       360
     gttcacacct acggtgcata caagtgtgca agagcagcat ggcctcactt ccggaaacaa       420
     aagtatggtc gtatcatcaa tactgcttcg gcagccggtc tcttcggcaa ctttggacag       480
     gcgaactact ctgctgccaa gctcggccag gtcggtttca ctgagaccct tgcgaaggag       540
     ggtgccaagt ataacatcat tgccaatgtt atcgctccca tcgctgcgag ccgtatgacc       600
     gctacaatta tgccacctga ggttttggag aacctcaagc ccgactgggt tgttcctctt       660
     gtcgccgttc tggtccaccc ctcgaatacc actgagagtg gctcaatttt cgaggtcggc       720
     ggtggccaca tggccaagct ccggtgggag cgtgccaagg gtgcgttgtt gaagactgat       780
     gcttccctga ctcccggggc cattgcaaga aagtggaagg atgtctacga ctactctcag       840
     ccggagtacc ctatcggccc cgccgacttc atgaccctcc tggagaatgg gatgaagaca       900
     cctagcgctc ccgctggaga agagcctgat ctgaagggca aggttgccct cgttactggc       960
     ggcggtaatg gtctgggccg ctcgtactgt cttctgttcg ctaagctcgg tgcatccgtg      1020
     gtggttaacg atctggtcga tcccgaacct gtcgtccagg agatcaagaa gatgggtgga      1080
     aaggccgttg gcaacaaagc ctcctgcgag gatggcgacg ccgtcgtcaa gactgccatt      1140
     gatgctttcg gccgcattga catcttggtc aacaacgccg gtatccttcg tgacaaggcc      1200
     ttcaccaaca tgaacgatga tctctggaac gctgttatca acgttcatct gcgtggtacc      1260
     tataaggtga ccaaggctgc ctggccccac atgctcaaac agaagtacgg tcgtattgtc      1320
     aacaccacta gcaccagcgg tatctacggc aacttcggac aggccaacta tgctgccgcg      1380
     aaattgggta tccttggttt ctcccgcgct ctggccattg aaggtgccaa gtacaacatc      1440
     aaggtcaaca ccattgcgcc taacgcgggc accaacatga cccgtaccat catgcccgag      1500
     gagatggttc aggccttcaa gcccgattat gttgctccga tggttgccct tctctgctct      1560
     gacatgtgcc cggagcccag cagcaagggt ctctacgagt gcggcagcgg atggttctcc      1620
     agcactcgct ggcagcgctc tggcggccat ggattccctg tggatgtgaa gctgactcct      1680
     gaaactgttc tcaagaactg gaagcagatc actgacttcg atgatggtcg tgctgaccac      1740
     ccccaggaca gccaggctgg tactgagaag gtgatggcca acatgtccaa ccgcagtggt      1800
     ggtgaaggtg gcaacaacat cctcgccaac attgagaagg ccaagcaggc caccactgag      1860
     ggcaccgctt tcgactatat tgaccgcgac atcatcctct ataacctcag cgttggtgcc      1920
     aaacgcacag accttcctct ggtgtacgag aacaatgaac acttccaggc tctccccact      1980
     ttcggtgtga tcccctggtt caacactgcc accccctgga acatggacga catagtggcc      2040
     aacttctctc ccatgatgct gctgcacggt gagcagtaca tggaaattcg caagttcccc      2100
     atccccaccg aggccaagac cttgacatac cccaagctca tcgacgtggt tgacaagggt      2160
     aaggccgctc tcgttgttgc tggatacaca accaaggatg ccaagaccgg agaggacctg      2220
     ttctacaacg agtccaccgt cttcattcgt ggcagcggcg gcttcggtgg ttcgcccaag      2280
     cccactgctt cccgccccaa gggtgccacg gcggcttaca accctcccaa gcgccagcct      2340
     gatgttgtga tcgaggagaa gacgtccgag gaccaggctg ctctgtaccg tctcaacggt      2400
     gaccgcaacc ctctgcacat tgatcccgag ttcagcaagg tcggtggctt caagactcct      2460
     atcctccacg gactgtgctc gctgggtatt tctggcaagc acgtcttcaa caagttcggt      2520
     gctttcaaga gtctgaaggt ccgcttcgcc ggtgtcgtgc tgcccggtca gaccctgaag      2580
     acagagatgt ggaaggaagg aaacacagtt atcttccaga cgactgttgt agagaccgga      2640
     aagcccgcca tcctgggcgc tggtgctgag ttgttggagg gagctaaggc taaattgtaa      2700
//

If you have problems or comments...

PBIL Back to PBIL home page