(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE277

ASFUM1_4.PE277       Location/Qualifiers
FT   CDS_pept        join(complement(1105824..1106041),
FT                   complement(1104973..1105750))
FT                   /codon_start=1
FT                   /gene_family="HOG000170830" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206316"
FT                   /orf_name="AFUA_4G03945"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27191.1"
FT                   /db_xref="HOGENOM:HBG332679"
FT                   /db_xref="UniParc:UPI0000F51AA7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA76"
FT                   /transl_table=1
FT                   /translation="MSRNALTPDGPVTIPAPAAERALKPPTAPTASASATASSRWNTDK
FT                   LGMRLGVDIASAMTAGALTCPVITVIDRAIIEKAAKGLPIRSTLTACFRSMLTRPAAFV
FT                   TSVPFLLIYTLYTSTYLTANAIDTLASTLRDRPFETVFPGTAKFLTTTAVNMGICVYKD
FT                   ARFARIFGAGNNAAASTTTGSRTGGGAPGGATCHPSGTSALKVPKISYALFCLRDSITI
FT                   FASFNVPALLAPRIPDGIVATAGGKSALAQFACPALMQFVSTPMHLLGLDLYNRQPVGG
FT                   LGWRERVGRIRRDYVASCFARMGKIVPAYGVGGVVNVRMREGLMRRLSAS"
     atgtcacgga atgccctcac cccagatggc cccgtcacca ttccagctcc ggccgcagaa        60
     cgagcattga agcccccaac ggcaccaaca gcgtcagctt cagctacagc ttcatcaaga       120
     tggaacaccg acaaactagg catgcgcctc ggcgtagaca tcgccagcgc catgacagca       180
     ggagcactaa cctgccccgt catcaccgtc atcgaccgag ccatcatcga gaaagccgcc       240
     aagggcctcc ccatccgcag caccctcacc gcgtgcttcc ggtccatgct cacccgcccc       300
     gcggcgttcg tcaccagcgt cccgtttttg ttgatctaca ccctctacac gtcgacgtac       360
     ctcactgcca acgcgatcga tactctggcc tcgacgctcc gcgatcggcc ctttgagact       420
     gttttcccgg gaacggccaa gtttttgacg acgacggctg tgaatatggg gatctgcgtg       480
     tataaggacg cgaggtttgc gagaatcttt ggggccggca acaacgccgc cgcgtctacg       540
     actaccggca gtaggacagg tggaggagcc cccggtgggg cgacctgcca cccatccggc       600
     acctcggcct tgaaggtccc caagataagc tacgccctct tctgtctacg ggatagcatc       660
     accatcttcg cgtcgtttaa tgtgcctgcg ctacttgcgc cgagaatccc cgatgggatt       720
     gtggctacgg cgggggggaa atctgcgctg gcgcagtttg cgtgtccggc tttgatgcag       780
     ttcgtcagta cgccgatgca tttgctgggc ttggatttgt ataatcggca gccggttggt       840
     gggctgggtt ggagggagag ggtgggcagg atcaggaggg attatgtggc gagctgtttt       900
     gcgaggatgg ggaagattgt tcctgcgtat ggggttggtg gggtggtgaa tgtgcggatg       960
     agggaggggt tgatgagacg cttgtctgct tcgtaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page