(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE283

ASFUM1_4.PE283       Location/Qualifiers
FT   CDS_pept        1123334..1125292
FT                   /codon_start=1
FT                   /gene_family="HOG000170785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749754"
FT                   /orf_name="AFUA_4G04000"
FT                   /product="LysM domain protein, putative "
FT                   /protein_id="EAL84549.1"
FT                   /db_xref="HOGENOM:HBG054420"
FT                   /db_xref="HOGENOM:HBG327806"
FT                   /db_xref="UniParc:UPI000051FB31"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R4"
FT                   /transl_table=1
FT                   /translation="MSSNNGIIDTFSPGAASTNTGSRSTSTVRPRTRRLISVDDVTDED
FT                   YEGPLQSTRLSTTTLSRDSSAVRSRGATPSPHTSRGTSPLPMRHPSRATESLNLDNLNR
FT                   FGGSLGGHSQTGKAQVKFADSSRAAVDFLDSSWTSLQSLASSFLGSDIARSAPNGTART
FT                   HARKPSRPDPYMRANPKTPSAWGPSTPSTSEIAAGTKEERLAMVQAKKREALLLADTGS
FT                   EASRDIRHKRRDSSDRTDHAAVDARQDEEALVYVHHVQPNDSITGVAIKYGCQPAIFRK
FT                   ANGFWPTDSIQSRKTVLLPVTSCSVKGRPIRAPTEIDLLGGDTSNRDSLEDLTGSSIAP
FT                   APSSDARASSTEGEAPTEAPLEGEADKIWKHQSWVQIDGFSAPVEIGRVPRKALGFFPR
FT                   TRRKSLSYTDSEPRSSISGRERTAALTSALPSPTESPSSQASTAQNRSSTDPSGARAIS
FT                   SAKPRPHHQRQRSNIQLVGTGVGTLDRSAMAPGPALDGLSKFVAQHLPQLAPAPAPPGL
FT                   GRTPSEYAAATASNASTSLDNIGGAVEGWVRKLTTRAKAGLSELQQSAQAYQSNTGART
FT                   SRRGMGDLIELDAGLESRDSSGLLPESSRKPNLNRSGSNLHDASLRERFPSPSSSGTSR
FT                   TRTGGSNLGYGNRVKDD"
     atgagttcca acaatggcat tattgacact ttcagccctg gggccgccag caccaacacc        60
     ggcagcagat ctacgtccac cgtccgacca cgcacccgcc gtttgatatc tgtcgatgat       120
     gttacagacg aggactatga aggaccattg cagtccacca ggctttctac cacaacgctc       180
     tcacgagact cctccgctgt ccgctcacga ggtgccaccc catcacccca cacgtcccgc       240
     gggacgtcac ctcttccaat gcggcatcct tctcgcgcca ctgagtcact caacctagat       300
     aatcttaaca ggttcggtgg ttccctaggc gggcacagtc agacagggaa ggcacaggtc       360
     aagttcgccg attcttcgcg ggcagcggtg gattttctag attcatcatg gacctcttta       420
     caaagcctgg catcttcttt cctggggagc gatattgccc gatccgcacc gaatgggacg       480
     gcacgtaccc atgcgaggaa gccttcgcga ccagacccgt acatgagggc taatccaaag       540
     acaccctcag catggggtcc gtcgaccccg tccacatcgg aaattgcagc tggaacaaag       600
     gaagagagac tggctatggt gcaggcgaag aagcgggagg ctctactact agcagacaca       660
     ggttcagagg ctagtcgcga cattcggcac aaaaggcgag attccagtga tcggacggac       720
     cacgcggcgg tcgatgcaag gcaggacgag gaggctttag tatatgtaca ccacgttcaa       780
     ccgaatgaca gcataactgg ggttgcaatc aagtatggct gtcaaccagc gatattccga       840
     aaggccaatg gattttggcc cacggatagt attcagagca gaaagaccgt gcttttgccg       900
     gttacctcct gttctgtgaa aggacggccg atccgtgccc cgaccgaaat tgatctttta       960
     ggaggcgaca cttcgaaccg ggattcttta gaggatctga caggaagctc gatagcacct      1020
     gcaccaagtt cagatgctag ggcttcctct accgagggag aagcacctac agaagcgccg      1080
     cttgaaggag aggcagataa gatctggaag catcagtcgt gggtgcagat agatgggttt      1140
     tctgcgccag tagagattgg ccgcgttcct cgcaaagcgt tgggattctt cccgcgtaca      1200
     cgacgaaaat ctctatctta cacagactcc gaacctcgtt catcaatatc cggccgcgag      1260
     cgaacggcag ctctcacttc agctctgcct tcaccgacag agtcgccatc atcgcaagcg      1320
     tccactgcac agaatcgaag ctccacagac ccttcagggg cgcgagccat atctagtgcc      1380
     aagccgagac cgcaccacca acgccaacgt agcaatatac agctcgtagg aacaggagtt      1440
     ggaacgctcg atcgcagtgc aatggctccc ggaccagctc tcgacggatt gagtaaattt      1500
     gtcgcacaac atctgccaca gttagctcct gcacctgcgc ctcctggcct gggaaggaca      1560
     ccgtccgagt atgccgcggc tacggcttcc aacgcttcaa ctagccttga caatataggg      1620
     ggtgcagttg aaggttgggt gagaaaatta acgactcgag cgaaagcagg tctcagcgag      1680
     ctgcaacaga gcgctcaagc gtatcagagc aatactggtg cgaggactag ccgacgtggt      1740
     atgggagatt tgattgaact ggacgctggc ttagagtcaa gggattcatc tggccttctg      1800
     ccggagagtt cgcggaaacc gaacctgaac cgatcaggat caaacctgca cgacgcatcc      1860
     ttgagagagc gtttccccag tccttcgtca tccggaacga gcaggactcg cacgggtgga      1920
     tcaaacctag gctatggcaa ccgagtgaag gatgattga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page