(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE287

ASFUM1_4.PE287       Location/Qualifiers
FT   CDS_pept        complement(1131962..1132423)
FT                   /codon_start=1
FT                   /gene_family="HOG000014315" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055114"
FT                   /gene_name="pptB"
FT                   /orf_name="AFUA_4G04040"
FT                   /product="Mitochondrial phosphopantetheinyl transferase B "
FT                   /EC_number="2.7.8.-"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL84553.1"
FT                   /db_xref="EMBL:AAY99390.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="HOGENOM:HBG054421"
FT                   /db_xref="HOGENOM:HBG327804"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI000051E59F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9R0"
FT                   /transl_table=1
FT                   /translation="MKLIPFPYPLNIGTDVVHLPRILRLINRPDYFHRFTRRILHEQEQ
FT                   RDFRTRFSLPPPSSGAEKTGLNPITPDMARWLAGRFAAKEAARKAAPAGASSLGWKDVI
FT                   VRVGEADKGRPEIVYLDPMGCGETGGGRVGKLSISHDGDYVVATVLAAG"
     atgaaactaa ttccttttcc atatcccctc aatataggga cggatgtcgt tcatctcccc        60
     cgaattctcc gcctcatcaa ccgtcccgac tacttccacc gcttcacccg gcggatcctc       120
     cacgaacagg agcagcgaga cttccgcacc agattctccc tcccaccacc atcgtccggc       180
     gcagaaaaga ctggactcaa tccaataacg ccagatatgg cgcgctggct ggctggccgt       240
     ttcgcggcaa aagaggcagc acgtaaggct gctccggccg gcgcgtcatc cctcgggtgg       300
     aaggatgtta ttgttagggt tggtgaggcc gataagggaa gaccggagat tgtgtacttg       360
     gatcccatgg gctgtggaga aaccggcgga ggcagagtag gcaagctgtc tatctcgcat       420
     gatggggatt atgtggttgc tacggtgctt gcggctggtt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page