(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE288

ASFUM1_4.PE288       Location/Qualifiers
FT   CDS_pept        join(1134381..1134479,1134556..1134641,1134677..1135289,
FT                   1135360..1135767)
FT                   /codon_start=1
FT                   /gene_family="HOG000170752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901731"
FT                   /orf_name="AFUA_4G04060"
FT                   /product="Putative uncharacterized protein "
FT                   /function="carbonate dehydratase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="carbon utilization"
FT                   /protein_id="EAL84554.1"
FT                   /db_xref="GO:0004089"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015976"
FT                   /db_xref="HOGENOM:HBG054422"
FT                   /db_xref="HOGENOM:HBG327802"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR019560"
FT                   /db_xref="UniParc:UPI000051EA54"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q9"
FT                   /transl_table=1
FT                   /translation="MFWGKRDHRDETPTDTPQQPIPREKLPAQLQKISFREAVPCRLSK
FT                   FILRNYGIIISACPRKIPRRPSFPRPPHHRTAMTNPSSNMDSSVDSTDTNYRYAGYVNR
FT                   IRTILLSAHRYVAYTSDIGESFRPVAHPYLVRTAYGISWTYLFGDVAHEGYKAYLRNRH
FT                   VLAPPGEAYKDAKDLSANEVVMGMATGDMGSPSAGTDAELAPWPTTRIPLIEDYRMVMV
FT                   KRAVFQSIASMGLPAFTIHSVVKYSGQMMKNNKNVFVRTWTPIGLGLAVVPFLPYIFDE
FT                   PVGEAVEWSFRTALRAYAGEDAVRPFPAPATASAAHPAETGADAPSVSRYLKTQAEKNS
FT                   SVALGADGSVAASANLSWEEYKAERQKAKEERRRQREAKGWTGPLAWLGLGSDSDSKSK
FT                   TE"
     atgttctggg ggaagcgaga tcatcgcgat gagactccca cagacacacc gcagcagccg        60
     atcccccgcg agaagcttcc tgctcagctt cagaaaatat cctttagaga ggccgttcca       120
     tgtcgcctgt ccaagtttat cctgcggaac tatggcatca ttatctccgc ctgtccccgc       180
     aaaatacctc gccggccttc tttcccacga cctcctcacc atcgcactgc aatgacaaac       240
     ccatcatcta acatggacag ctccgtcgac tcgaccgaca ccaactaccg ctacgccggt       300
     tacgtcaacc gcattcgtac catcctcctc tccgcccacc gctacgtcgc ctacacctcc       360
     gacataggcg agtcgttccg ccccgtcgca cacccctacc tcgtgcgcac cgcctacggc       420
     atctcatgga cctatctgtt tggtgatgtc gcccacgaag gctacaaagc ctacctgcgc       480
     aaccggcacg tcctcgcccc acccggcgag gcctacaagg acgccaaaga cctctcggcc       540
     aacgaggtcg tcatgggcat ggcaacaggc gacatgggca gtcccagcgc cggcaccgat       600
     gccgagctcg ctccctggcc gacaacccgc atccccctca tcgaggacta ccgcatggta       660
     atggtcaaac gggccgtgtt ccagagcatc gcaagcatgg ggctgccggc gttcacgatc       720
     cactcggtgg tgaagtactc cgggcaaatg atgaagaaca acaagaacgt ctttgtgcgg       780
     acatggaccc ctatcggcct gggccttgcc gtcgtcccct tcctcccata catcttcgac       840
     gaacccgtcg gcgaagcagt ggaatggtcc ttccggaccg ctctccgcgc ctacgcaggc       900
     gaggacgccg tccggccctt ccccgccccg gccacggcct cagccgctca ccccgcagag       960
     acaggcgcag atgcaccttc cgtatcgcgc tacctcaaga cccaagcgga gaagaactca      1020
     tccgtggcgc tcggagccga cggttccgtc gcagcgagcg cgaatctctc ctgggaggag      1080
     tacaaggccg agcggcagaa ggccaaggag gagcgtaggc ggcagcgcga ggccaagggc      1140
     tggacgggac cgctcgcttg gttggggctc gggtcggact cggactcgaa gagtaaaacc      1200
     gagtaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page