(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE289

ASFUM1_4.PE289       Location/Qualifiers
FT   CDS_pept        complement(1136730..1139435)
FT                   /codon_start=1
FT                   /gene_family="HOG000170741" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259039"
FT                   /orf_name="AFUA_4G04070"
FT                   /product="Mucin family signaling protein Msb2, putative "
FT                   /protein_id="EAL84555.1"
FT                   /db_xref="HOGENOM:HBG054423"
FT                   /db_xref="UniParc:UPI000051FDA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q8"
FT                   /transl_table=1
FT                   /translation="MRPATLVAALLSLGGLELVAAENAQELKPRFIPKQFKRHVVHGPD
FT                   SSATTSSNTNIHLDKRADVNPFISYFNSLLQNGPTATSSAPLVSLPIIVSIDASGVTHT
FT                   ITPTPTPSPSAETSSDATSGSTLEPSSATDQSAPNNVPATALSTAQTSSPAKTDTSDNS
FT                   QTAPASSPATSSGNTVSDTLSAVVSSVLGDPSSSTSTSPPVSSSATDGSKAPESSTTVS
FT                   AAQTSQAKTDPSDNSQTTPASSTPATSSGNVVSDALGGVGGLVSSVLGNPSSSTIAVPT
FT                   ATEAKSTGSSATESNDPSTNSTTPTGSSSPAAPVETTPTPAASSSGLLDTVASDLSGIL
FT                   PTASSSLASGAATTDSSNADGTVTHSTVVIPSSTGNNSSPEASPSPTPSPSGVLDPLTS
FT                   AVTDLLPGSASSSAVTNGSSGAETSASTDLGQSTVPVSVPAVTPSATSSSGLGGILGPI
FT                   LSSAGSTGVIPTASTHTSSFVGVPTGLTSILIPGGSSGSESPTSYTQISPSVPTTAPSV
FT                   TSTAVIPGSSDTAIGSSIAVTGSTGVSSTLPTPTADFSSSAIQTLSTTEQTTPSPSTTP
FT                   ETTTAAPTTTTTSTTYPPETTTTENTDFVPSSILVEPTTTTQLSTAETATGTNRPAQLP
FT                   GSISPANGLTSPPPDSTLIQLGFNGKLRYSFVATTPLSSSQIFLYIPQGLIYALEILGK
FT                   DIAMFAIQPYDNSASTGYIATVALAYIPTDKVDTLRKLLRSPLSKLYQQPNESVKTLFS
FT                   MIDPSIPLVVGESGSSSGSGLYSDSGISGSGSSSDGNGSGSNSGNDADAGASRSASARA
FT                   SSVGIGVGVVCGAAAYGAGMFWVARRYRKKRQLHRRSNSTMEQTSEGRGAGSLFAAGGR
FT                   LSRNSQNSRGSGRGQMISAPVMAENSLGWN"
     atgcgtcctg caactcttgt tgcggccctc ctgtccctgg gaggtctcga gcttgtcgcg        60
     gctgaaaatg cccaggaatt gaagccgcgc ttcatcccca aacaattcaa aagacatgtc       120
     gtccatggac ctgattcctc tgccactacg tcgtcgaaca cgaacattca cttggataaa       180
     agggctgatg tgaatccctt catctcttac ttcaatagcc tgcttcaaaa cggccccacg       240
     gcaacatcca gcgccccgct cgtctccctg cccatcatcg tctcgataga tgccagcggt       300
     gtcactcaca ccattacccc aacccccaca ccgtcccctt cagcagaaac atcttctgat       360
     gccacgtccg gttcaacgct cgagccatct tctgcgaccg atcagtctgc tccgaacaac       420
     gttcccgcga cggctctctc aacggcgcag acctcctctc cggccaagac agacacctca       480
     gacaactccc aaactgcacc agcctcatcg cctgccacaa gcagcggaaa taccgtcagc       540
     gacaccttga gtgccgttgt cagcagtgtt ctgggagacc cgagcagctc aaccagtacc       600
     agccctccag taagctcatc tgccactgat ggatccaagg cccctgagag ttcgacaacc       660
     gtatcagcag cgcagacatc tcaggccaag acagacccct ctgacaactc ccaaactaca       720
     ccagcctcat caactcctgc cacaagcagt ggaaatgttg ttagtgatgc cttgggtggt       780
     gtgggtggcc ttgtcagcag tgtactcgga aacccgagca gctcaaccat tgccgttcca       840
     accgccactg aagccaagag cacagggagc tcggcgaccg agagcaatga tcccagcaca       900
     aactctacga cgccaacagg ttcctcatct cccgctgcgc ccgttgaaac gactccaacc       960
     ccagctgcga gctcgtccgg cctccttgac actgttgcct cggatctctc tggaattctg      1020
     cctacagctt ccagttccct tgcgtccgga gctgccacta ccgattcgtc caacgctgat      1080
     ggcactgtta cgcactcaac agtcgttatt ccctcttcga caggcaacaa ctcctcgcct      1140
     gaggccagcc cctccccaac tccaagcccg agcggcgtac tcgatccgtt gacctctgct      1200
     gttactgacc tattacctgg ctccgcatca tcctcagccg tgaccaacgg tagcagtgga      1260
     gctgagacct cggcatccac agaccttggt cagtctactg tgcctgtcag cgtccctgct      1320
     gtgacaccct ctgccaccag ttcgagtggc ctgggtggaa ttctgggtcc tatcctcagt      1380
     agcgctggta gcactggagt cattccaacc gcaagcactc acaccagcag ctttgttggc      1440
     gtccctaccg gcttgactag tatcctcatc ccaggaggca gcagcggaag tgagtcgcca      1500
     acttcgtaca ctcagattag tcctagcgtt cctacaactg ctccctctgt gaccagcacc      1560
     gccgtcattc ctggtagctc cgataccgct attggttcct cgattgctgt cacgggatcc      1620
     accggagtga gctcgacttt gcctacacct actgccgatt tcagcagctc agcaattcag      1680
     acactctcta caacggagca aacgactcca agtccgtcaa ccacgccgga gaccaccacg      1740
     gctgccccca ccaccactac caccagtact acttatccac ccgaaactac caccaccgag      1800
     aacaccgact ttgttccctc cagtattctg gtggagccta caaccacgac tcagctctca      1860
     acggctgaga ccgctactgg caccaatcga cccgctcaat tgcctggatc catctcgcca      1920
     gccaatggtc tgaccagccc tccaccagac tctactttga ttcagctcgg cttcaatggc      1980
     aaactccgat acagcttcgt tgccacaacc ccgctctctt catcgcagat cttcttgtac      2040
     attccacagg gactgatcta tgctttggag attctcggca aagatattgc gatgttcgcc      2100
     atccagccgt acgacaactc ggctagcacg ggttacattg caaccgttgc cttggcttat      2160
     attcctacag acaaggttga cacattgagg aagctgctcc gcagtccatt gtccaaactc      2220
     taccaacagc ccaacgagtc ggtcaagacc ctgttctcga tgatcgatcc ttctatccct      2280
     cttgttgttg gagaatccgg ctcatctagt ggcagcggat tgtatagcga cagtggaatc      2340
     agcggcagtg gtagcagcag tgatggtaat ggcagtggca gtaactctgg caacgatgcg      2400
     gatgccggtg ccagtcgcag cgcttcggct cgtgccagct ctgttggcat cggcgttggt      2460
     gtcgtatgcg gcgctgcagc ttatggtgcg ggtatgttct gggttgctcg tcgctaccgc      2520
     aagaagcgtc aattgcatcg ccgctccaat tccactatgg agcagacgag tgaaggtcgt      2580
     ggggccggtt ctctcttcgc cgctggcggt cgtctttccc gcaacagcca gaatagccgg      2640
     ggaagtggcc ggggccagat gatcagtgct cctgtcatgg ccgagaactc cctgggctgg      2700
     aactaa                                                                 2706
//

If you have problems or comments...

PBIL Back to PBIL home page