(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE292

ASFUM1_4.PE292       Location/Qualifiers
FT   CDS_pept        join(complement(1151583..1151683),
FT                   complement(1149658..1151170))
FT                   /codon_start=1
FT                   /gene_family="HOG000170708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749755"
FT                   /orf_name="AFUA_4G04100"
FT                   /product="Vacuolar protein sorting protein (Vps36),
FT                   putative"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL84558.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059077"
FT                   /db_xref="HOGENOM:HBG327797"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="UniParc:UPI00005201FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q5"
FT                   /transl_table=1
FT                   /translation="MFFKSLDLTTALRPSLLPDETLLFVQDAVGLYEGSQCPLPATPYK
FT                   QPAPKPINATWVCPICSFTNPVPSNFDPATATASTPLSPCLACGIKPPFTTVLKAAITA
FT                   AASREAAQVHPASHEPGQPESNDDETVRKPNASTPCPRCTFVNHPYLLECEICGAPLAP
FT                   AVARGASVDGSRRSESPAPVFGQGNIANTETFEVVKLSFRGGGEKTFYERLKGALVQRK
FT                   WLLYDAPPVPQQPSQSPATPNLTASGAVAANVSTPAQPRSPAVGIAGLEQRGLEARRNN
FT                   EVVIGSSFEDLEALMASAKRIINLAETLARESGMAGDENTAATNAVLSESAAALGMTTT
FT                   KDMLGSGAENLYLSELSRDLAEYLTDDNKGILQKEGGIMSLVDLWAMFNRSRNGVELVS
FT                   PSDFQKAAELWEKLKLPVRLRRFKSGLLVVQRYDWNDEKTIRQLQEWMAELRQIPPADP
FT                   VPWDWRQFGRAVTAQEAAQRFKWSVGVAAEELEMAEDKGVLCREEGIEGLRFWSNYITS
FT                   DLSSMNSIDSIDLRVSSLAI"
     atgttcttca agtctctaga tctgaccact gcactccgtc cctcattgtt acccgatgag        60
     actttgctct tcgtccagga tgcggtgggg ttatacgaag gttcgcagtg tccgctcccg       120
     gcaaccccat acaagcagcc ggcaccgaag cctatcaacg cgacctgggt ctgtccgata       180
     tgctcgttca ctaatccggt gccttctaat ttcgacccag caacggctac tgcttctact       240
     cccttgtcgc catgcttggc ttgtggcata aagccgccat ttacgaccgt tctgaaggcc       300
     gcaatcacag ctgccgctag tcgcgaagcc gcccaagtac atccagcttc acatgagcct       360
     ggtcaacccg aaagcaatga tgatgaaact gtacgcaagc ctaatgcctc cacaccatgt       420
     cccagatgta catttgtgaa ccatccttat cttctcgagt gtgaaatatg cggggctccc       480
     ctagcccccg cagtcgcccg aggggcgtct gttgatggct cacgtcgatc agaatcccca       540
     gcgccggtat tcggacaagg aaacatcgcc aatactgaga cttttgaggt agtcaaatta       600
     tccttccgcg gaggcggtga aaagactttc tatgaaaggt tgaaaggcgc cttggtccag       660
     cgaaagtggc tgctctacga tgcgcctcct gttccgcagc agccatcgca atcgcctgcc       720
     acgccgaatc ttacagcctc tggtgctgtt gccgccaacg tctccacgcc agcccaaccc       780
     cggtcccccg cagtaggaat tgcgggcctt gagcagcggg gacttgaagc tcgtagaaat       840
     aacgaggtgg taataggcag ctcgtttgaa gatcttgaag ccttgatggc gtctgctaaa       900
     cggatcatca atcttgctga aacgctcgcc agggaatcag gcatggccgg tgacgagaat       960
     actgcagcaa ccaacgcagt gctgtcagaa tccgctgccg ctcttgggat gaccacgacc      1020
     aaagatatgc ttggctctgg tgccgagaat ttatatctct ctgaactctc acgggacttg      1080
     gcggagtacc tcaccgacga taacaagggt atcttgcaga aagaaggcgg tatcatgagt      1140
     ctggttgatc tttgggcgat gttcaatcgc tcccgaaatg gggtggaact agttagtcct      1200
     tctgacttcc agaaagcagc agagctctgg gaaaaactga aactacctgt tcggctgcgg      1260
     cgattcaaaa gtggtcttct tgttgttcaa cgctacgact ggaatgatga gaagaccatt      1320
     cggcaactgc aagaatggat ggcggaactt cgtcagatac cgcccgccga tccagtaccg      1380
     tgggactggc gtcaatttgg gcgtgccgtg acagcacaag aggctgctca aaggttcaag      1440
     tggagtgtcg gagtcgcagc agaagagcta gaaatggctg aggataaagg tgtcctatgt      1500
     cgcgaggaag gcatcgaagg gttaagattc tggagcaact acatcacctc cgacctttct      1560
     tcgatgaata gcattgattc gattgatttg agggtgtcta gcctggccat atga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page