(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE293

ASFUM1_4.PE293       Location/Qualifiers
FT   CDS_pept        join(1152248..1153626,1153685..1153901)
FT                   /codon_start=1
FT                   /gene_family="HOG000170697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206317"
FT                   /orf_name="AFUA_4G04110"
FT                   /product="SAC3/GANP domain protein "
FT                   /protein_id="EAL84559.1"
FT                   /db_xref="HOGENOM:HBG243792"
FT                   /db_xref="HOGENOM:HBG735264"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniParc:UPI000051F3EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q4"
FT                   /transl_table=1
FT                   /translation="MSSGIPPWRTTASATATTAHFPAHGMCFLTLISLYSISNCDLATP
FT                   AYIPVQARRSFAHTSTTAMVPQPQPTTTQAPRKRVEWPAPLRSYVQRSFAPENQLPGVN
FT                   RQEMEVKLKGVITEAAEKGQLEKINWDALPLPQVMIQNERNQILTNPAVSGWSDSLLTA
FT                   AQKPDTVTEDVSRKRKSAEYGDKDSCPPWRQTNNHHAFGDRTTYPSADKRQRVDHKNPS
FT                   KSKANLEMRRKRFEEPRARYGSSPSSSRGESPAPSANQGPVVGRCQELEKNYFRLTSAP
FT                   NPDTVRPLHVLHKTLDLLKKKWKKDNNYGYICDQFKSLRQDLTVQHIRNEFTVSVYEIH
FT                   ARIALEKGDLGEYNQCQTQLRALYAQNLGGHPTEFKAYRILYFIHTRNWTAMNDALADL
FT                   TAADKRDPAVKHALDVRSALALGNYHRFFQLYLDTPNMGAYLMDMFVDRERLSALAAIC
FT                   KAYKPDVKIRFITEELGFESDEQSARFILDHASEDLLQEKDGSVRLFTSGRAAQLFEAA
FT                   KSEAHRVVDIKGQI"
     atgagttctg gtatcccacc ttggcgtact accgcatccg cgactgctac gaccgctcac        60
     tttcctgcac atggtatgtg ttttcttact ctaatatctt tgtattcaat ttctaattgt       120
     gacctagcaa cccctgcata tatccctgtt caagcacgtc gtagctttgc tcatacatcc       180
     accaccgcca tggtacctca gccgcagcca acgacaactc aagcacctcg caaacgagta       240
     gaatggccag ccccccttcg atcatatgta caacgaagct tcgcgcctga gaaccaactt       300
     cctggagtca accggcagga gatggaggtg aaactgaagg gtgttattac tgaggcggcg       360
     gagaagggtc agctggagaa gatcaactgg gatgcattgc ccctaccgca agtcatgatt       420
     caaaacgagc ggaaccagat tcttaccaac ccagctgtct ctggttggag tgattcactt       480
     ttaactgctg ctcagaaacc ggacaccgtt accgaggacg tttctagaaa aaggaaatcg       540
     gctgagtacg gggacaaaga cagctgtcca ccatggaggc agactaacaa ccatcatgca       600
     tttggagatc gaactactta tccctcagca gacaagcgtc agcgtgttga tcataagaac       660
     cccagtaagt caaaagctaa tctggaaatg cggaggaaac gtttcgaaga accgcgggcc       720
     aggtatggct cttcgccatc ctcatctcgt ggggaatccc cagcgcccag tgccaatcag       780
     ggacctgttg ttggacggtg ccaggagcta gagaagaact acttccgctt gacttcagcg       840
     ccaaacccag acaccgttcg accgctgcat gttttgcaca agaccctgga tcttctgaaa       900
     aagaaatgga agaaggataa caattatgga tatatttgcg accagttcaa gtctctgcga       960
     caagatctga ctgtccagca catcagaaat gagttcactg tcagtgtcta tgagattcat      1020
     gcccgcattg cgctcgagaa gggagatctt ggtgagtata atcaatgtca gacacagctg      1080
     cgagctttat atgcccaaaa tctcggtggg caccctacag aatttaaggc gtatcgtatt      1140
     ctttacttca tccacacccg caattggacg gctatgaacg atgcgttggc cgatctaaca      1200
     gcagcagaca agcgtgatcc tgctgtcaaa catgccttgg atgttcgctc agcccttgcc      1260
     ctgggaaact atcatcgttt cttccagctt tacctcgaca cccctaacat gggggcttat      1320
     ctgatggaca tgtttgtgga ccgcgagcga ctttccgcac ttgcagccat ttgtaaagct      1380
     tacaaacccg acgtaaagat acgttttatc actgaggaac ttggcttcga gtccgatgaa      1440
     cagagtgcac gctttatcct ggaccatgcc tctgaggatt tacttcaaga gaaagatgga      1500
     tccgtgaggc tgttcacgag cggcagggct gctcaactct tcgaggcggc caagtccgaa      1560
     gcccacagag tcgttgatat aaaaggacag atttga                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page