(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE294

ASFUM1_4.PE294       Location/Qualifiers
FT   CDS_pept        join(1157175..1157180,1157480..1157581,1157782..1158549,
FT                   1158614..1159534)
FT                   /codon_start=1
FT                   /gene_family="HOG000170685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259041"
FT                   /orf_name="AFUA_4G04120"
FT                   /product="Protein kinase activator Bem1, putative "
FT                   /function="kinase activity"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="EAL84560.2"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG174475"
FT                   /db_xref="HOGENOM:HBG397148"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0000F51A8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Q3"
FT                   /transl_table=1
FT                   /translation="MKAIRRSLKGEKDPKPHHHHLSITPKSAIAILPPKKVIKALYDYQ
FT                   PEPGNTQELAFSKGDFFHVISREDDLDWYEACNPLIPSARGLVPVSFFEVIGKNERDSG
FT                   GSVDLHKKKESHDSGFSDRGPAQFSSPDHTPTQLQHSPSTPRMSTLGKASSAMVYGIVQ
FT                   YDFQAERPDELDAKAGEAIIVIAQSNPEWFVAKPIGRLGGPGLIPVSFIELRDMQTGQA
FT                   VSDPLEAVKRAGVPRVEEWKKMTAEYKNSSITLGKIDSAASAVQSVTSGVEKMSMGRNS
FT                   AGHAGQNGNAYGYHNRNASKASLPQHLSQPPMPNHHQQPLVAPVAASIPRYCFDNDKYW
FT                   YIIEAKMEDGRCWELSRYYHDFYDFQIALLTQFEEEAGNRGKPRTLPFMPGPVTHVTDA
FT                   ISNGRRQNLDEYIKKLLAMPPHISRCQLVRQLFAPRPGDFEIDPSAFGEDARYSGGSHH
FT                   SSTQETSRTASRQSSQAQMSSHPDRASHQRNQPSVSHAADRPAPMNRQASSLTQVSTTS
FT                   SGGAMKVKVFFQDDLIAIRVPSDISFQQLREKLLDRLKLNEEIVVQYKDEPSGAYMDLN
FT                   NDSDLDTAMQRNSKLTLHVGLA"
     atgaaggcca tcaggcgatc tctcaaaggg gaaaaagacc ctaaacctca ccaccaccat        60
     ctttcaatca ctcccaagtc agccatcgcg attctgccac ctaagaaggt gatcaaagct       120
     ctctacgact accaaccaga acccggcaac acgcaagaat tagcgttcag caagggcgac       180
     ttctttcacg ttatcagcag ggaggacgac ttggactggt acgaagcgtg caacccactc       240
     atccctagtg ccagggggtt ggtacctgtc tccttttttg aggtcatcgg caagaacgaa       300
     agagatagtg gcgggtcggt cgatcttcat aagaagaaag agtcgcacga ctcgggtttc       360
     tcagatcgtg gtcccgctca gttttcctct cccgatcata ctcccaccca gcttcagcac       420
     tccccatcga ctcccaggat gtcgacgtta ggaaaggcct cgagcgccat ggtctatggt       480
     atcgtccagt atgacttcca agcagagcga ccggatgaac tcgacgcgaa agcaggggaa       540
     gcgatcattg tcatcgccca gtccaacccg gagtggttcg tcgcaaagcc catcggtcgt       600
     ctaggtggcc ccgggttgat ccccgtctca ttcatcgaac ttcgggacat gcaaaccggt       660
     caagcggtat ccgatccttt ggaggcagtc aagcgcgctg gtgtaccaag ggttgaagaa       720
     tggaagaaaa tgaccgccga atacaagaac agcagcatca ccctcggcaa gattgactcg       780
     gccgcgtcag cagtgcagtc cgtgacctct ggagttgaga agatgtccat ggggcgcaac       840
     agcgccggcc acgcaggcca aaatggaaat gcctacggct atcataatcg gaatgcgagc       900
     aaagcgtccc tacctcaaca cctgtcgcag ccgccgatgc cgaatcacca tcagcagcct       960
     ctggtcgccc cagtagccgc atccattccc cggtactgct ttgataacga caagtattgg      1020
     tatatcattg aggccaagat ggaggacggc cgttgctggg agttgtcccg ttattatcat      1080
     gacttctacg atttccagat tgcgcttctg acccaattcg aggaggaggc cggaaaccgc      1140
     ggcaagccgc gcacattacc atttatgccc ggacctgtga cgcatgtcac cgatgcgatc      1200
     tccaacggcc gtcgccagaa cttggacgaa tacataaaga agctcctggc catgcctccc      1260
     catatctccc gctgtcagct ggtgcgtcag ctattcgcac ctcgcccagg tgactttgaa      1320
     attgacccga gcgcgtttgg agaagatgct cggtactccg gtggctcgca ccattcctcc      1380
     acacaggaga cctcgcgcac cgcgtcccgc cagtcatctc aggctcagat gagctcgcat      1440
     cccgaccgag cctcgcacca gcgcaatcag ccctccgtct cgcatgcggc cgacagacca      1500
     gcgccgatga accgacaggc cagctctctc acccaagtgt caacaacctc aagcgggggc      1560
     gccatgaaag tcaaggtttt cttccaggac gacttgattg ccattcgcgt ccctagcgac      1620
     atcagtttcc agcagctccg ggagaagcta ttagatcgcc tcaagctcaa tgaggaaatc      1680
     gtggtgcaat ataaggacga accatctggc gcgtacatgg acctaaacaa tgacagtgac      1740
     cttgacaccg ccatgcagcg gaattccaag ctcaccctac acgtcgggct tgcataa         1797
//

If you have problems or comments...

PBIL Back to PBIL home page