(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE304

ASFUM1_4.PE304       Location/Qualifiers
FT   CDS_pept        join(1182850..1183261,1183377..1183893,1183970..1184165)
FT                   /codon_start=1
FT                   /gene_family="HOG000170652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259050"
FT                   /orf_name="AFUA_4G04220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84570.1"
FT                   /db_xref="HOGENOM:HBG054433"
FT                   /db_xref="UniParc:UPI00005201F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P3"
FT                   /transl_table=1
FT                   /translation="MAIHPTLPSQANSQGRLTPQQTRAISAWSEQAAASLRNLTLSESV
FT                   SASDRNVEFISTRDSPLRGSSVPLSIPLDDPAPVVHTGAVPRVKLVTRESETQPVASVS
FT                   FRRREPIRRDSLKRREALLKGKDGSRRRQRWENDRLLHNPWVEPPAPSDWAVQPTYPRH
FT                   DPMPYYLAPLWDMKYAHLDRTSSQQTQKGTRHEKHRVPKELRMRLKHARAARGMLQDLE
FT                   EDIRQFIQTWSEKQLMLRKEGLEDAPLSSEDESEDEVVFVGRNGQMHDSPEHKTRLREL
FT                   RANLSQHNERDGEKMVFESPVDDRAAGFGYYGLHTWSITVGEPARREAYVGFHMPAPGS
FT                   RPGLTTHVSVPSNAQQGAMMKPGDDLPKPLWAQI"
     atggccatcc atccaacact gccatcccag gccaactcac agggacgcct gacacctcag        60
     cagactcgag caatctcagc ttggtcggag caggcggctg catccctgcg gaatttgact       120
     ctctcggagt cggtatcggc cagcgacaga aatgtcgaat tcatttcgac gcgtgattcc       180
     cctctgcgcg gatcctcggt tcctctatct attcctcttg acgacccagc tcctgtggtg       240
     catacgggag ccgtacccag agtcaagctt gtgactcgtg agtccgagac gcaaccggtt       300
     gcctcggttt cgttcagacg tcgagaacct attcgtcgcg atagtctgaa gagacgggaa       360
     gcgctcctca aaggaaagga cggaagtcgg cgcagacaac gttgggagaa cgatcgtctc       420
     ttgcataacc cttgggttga acctcctgcg cccagtgact gggcggtaca gccgacatat       480
     ccgcgacatg atcccatgcc ttactatctg gcacctcttt gggacatgaa atatgctcac       540
     ctcgatcgga cgtcttctca gcagactcag aaaggtacga ggcatgagaa gcatcgcgtt       600
     cccaaggaac ttcgcatgag attgaagcat gcacgtgctg ctcgcggaat gctccaggat       660
     ttggaagagg atattagaca gttcatccag acatggagcg agaagcagct gatgctgcga       720
     aaagaaggct tggaagatgc accattatca tctgaggacg aatctgagga tgaagttgtc       780
     tttgtggggc gcaatggaca gatgcatgac tcgcctgagc acaagacaag gttgcgagaa       840
     ctgcgcgcga atttaagcca acataacgag cgagatggag agaagatggt gtttgagagc       900
     ccggttgatg accgggccgc tggctttggt tactacggcc tgcatacatg gtcgatcacg       960
     gtgggggaac ctgctcgccg tgaggcctat gttgggttcc atatgccggc gccaggtagt      1020
     cggcctgggc tcacgactca cgtatctgtc ccatcaaatg cccaacaagg ggctatgatg      1080
     aagcctggcg atgaccttcc gaagccactc tgggctcaga tctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page