(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE305

ASFUM1_4.PE305       Location/Qualifiers
FT   CDS_pept        join(1188106..1189178,1189468..1189492,1189628..1189876)
FT                   /codon_start=1
FT                   /gene_family="HOG000170641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259051"
FT                   /orf_name="AFUA_4G04230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84571.1"
FT                   /db_xref="HOGENOM:HBG054434"
FT                   /db_xref="HOGENOM:HBG327704"
FT                   /db_xref="UniParc:UPI00005201F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9P2"
FT                   /transl_table=1
FT                   /translation="MESYSASSCQDRCARTRRSSGSTNSEASDRSKSTVPTVYSYRPTS
FT                   KRQPETDRFTMDPRDSTSTYASTIPSTDGLPEDPQYEVIDRKPEIYATDAIPSSPTTFA
FT                   ELFPSSRRLLIRHDDSTLDGNMNLRVDTLVPRRGGYQQDVILFHLRMYDLFSRKFSFRR
FT                   YCRESGREICHSERRPRSSSIDKRPILQRSWSSVLASLRPGSSGNGTIAGAEHKRHNSG
FT                   HHSIKQEGANLDDATADAKEYPSRPVALADTTVLEFSNYAHVEVKRRGAGIPKRYEFEY
FT                   WSTKYYWKKECRKEGDLREVSYHLINTRTSKIIAHIVPEILTPVEAVEEESKGGWVPSS
FT                   SMWISDSSVYEKMHEVAENLGKFAATAGSLACPCIWFAGDEDPSWTCLLVVVVVVVVVV
FT                   VVVVVVVVVVVVVVVVIVPRMCNRNSAASSYRCVDTCRSTESDDLLSGV"
     atggaatctt acagtgcatc atcgtgtcaa gatcgttgtg cccgaacaag gcgcagctct        60
     ggttcgacca acagcgaagc ctcggatcgg tcgaaaagca cggtccctac ggtctacagc       120
     tatcggccca catctaagcg acagccagaa acggatcgct tcacgatgga ccctagagat       180
     tctacatcga cgtatgcatc cacgatacca tcgaccgacg ggttaccgga agacccgcaa       240
     tatgaggtta tcgaccgaaa gccggagatc tatgccactg acgcgatccc ttccagtcca       300
     accacttttg cagagctatt cccctcatcc cgacggctac tgattcggca cgatgattcg       360
     acactagatg gtaatatgaa tctacgggtc gacactttag tgcctcgaag gggcggctat       420
     caacaagatg taatcctttt tcatctccgc atgtatgact tgttctcgag aaagttctca       480
     tttcggcgct actgtcgcga gtctggtcgt gagatctgtc actcagaaag gaggcccaga       540
     tcgtccagta tcgacaagag gcccatcctc cagcgctcct ggagcagtgt gttggcaagc       600
     ttgcgacctg ggtcgagtgg gaatggaacg atagctggcg ctgaacataa gcgccacaac       660
     tcaggacatc actcgatcaa gcaggaaggt gcaaatttgg atgatgcaac agcagatgcc       720
     aaggagtatc ccagtcgccc agtcgccctc gcagatacaa cggtgttaga attttctaat       780
     tatgcgcatg tagaggtcaa gaggcgaggc gcagggatac ccaagcggta cgaattcgag       840
     tattggtcca cgaaatacta ctggaagaaa gagtgcagga aagaaggaga tttgcgagaa       900
     gtgtcctacc atctcatcaa cacgcggacg tccaagatta tcgctcatat tgtgcccgag       960
     atcctcacgc cggtggaagc tgtcgaggag gagagtaagg gcggttgggt tccttcgtcc      1020
     tcaatgtgga ttagcgattc atcagtgtac gaaaaaatgc atgaggttgc cgagaacttg      1080
     ggtaaattcg ccgctacggc tggatccctt gcatgtccgt gtatctggtt cgctggcgac      1140
     gaggatccca gctggacttg cttgttagtt gttgttgttg ttgttgttgt tgttgttgtt      1200
     gttgttgttg ttgttgttgt tgttgttgtt gttgttgttg ttgtcattgt ccctcgaatg      1260
     tgtaacagga actctgcggc ctctagttat cgctgtgtcg acacttgtcg gtcgactgag      1320
     tcggatgacc tcctttcggg tgtttag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page