(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE309

ASFUM1_4.PE309       Location/Qualifiers
FT   CDS_pept        complement(1200318..1201256)
FT                   /codon_start=1
FT                   /gene_family="HOG000170619" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901733"
FT                   /orf_name="AFUA_4G04280"
FT                   /product="AN1 zinc finger protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL84575.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054436"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniParc:UPI000051EEFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N8"
FT                   /transl_table=1
FT                   /translation="MAPITVSKGRTPSPNAQESFTQTADKDLESIGRHCQFEYCHQLDF
FT                   LPFRCESCRGTFCLEHRTETAHRCPKAGEWARRRNGNQNTSTASLPTQKPTIYNSDQCA
FT                   HLDCKTLINTLKDPGVRCPDCNRQYCLRHRLREEHECTKIAPLGARAGSQGPSNAETIR
FT                   SMFARVRTWGKDKGQALAPKPKANSAAARISELNALKKAAKGDAGIPADKRLYLHVVGT
FT                   ADAQAQKAEPPSGDFWFDSRWKVGRVLDDAARRLRIENVNNRAGEEERLRIFHVDSGEF
FT                   LEFSETIGDGKVKQGHTIVLLRGAGVILGKS"
     atggcaccca taaccgtctc aaaaggccgg acacccagtc cgaacgccca agaatccttc        60
     acgcaaacgg ccgataagga cctagagtcc atcggccgac actgtcaatt cgaatactgc       120
     caccaactcg acttcctccc tttccgctgt gaatcctgcc gcggaacctt ctgcctcgag       180
     caccgcaccg aaaccgccca ccgctgcccc aaagccggcg aatgggcccg ccgccgcaac       240
     ggaaaccaga acaccagcac cgcgagcctt cccacgcaga aacccacaat ctacaactca       300
     gaccaatgcg cccatctcga ctgcaagaca ctcatcaaca cgctgaaaga tcccggcgtg       360
     cgctgcccag actgtaatag acagtattgt ctacgccacc ggctccggga agagcacgag       420
     tgcacgaaga tcgcgccgct tggcgctcgg gcaggcagcc agggcccaag caatgcggag       480
     acgatccgct cgatgttcgc gcgggtgcgc acatggggaa aagacaaagg acaggcgctg       540
     gcgccgaagc ctaaggccaa tagcgcagct gcgcgaattt cggagctgaa tgcactcaag       600
     aaggcagcaa agggtgatgc aggcatcccc gctgacaagc ggctgtatct gcatgtagtt       660
     gggacggcag atgcgcaggc acaaaaggcg gagccgcctt cgggggactt ttggttcgat       720
     tcgaggtgga aggttgggcg ggtgctggat gatgcggcgc ggaggttgcg gatcgagaat       780
     gtgaataatc gggccgggga ggaggagcgg ttgcggatct tccatgtgga ttcgggggag       840
     tttttggagt tctcggagac gattggggat gggaaggtga agcagggtca tactattgtc       900
     ttattgagag gggcgggagt tattctgggg aagtcgtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page