(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE311

ASFUM1_4.PE311       Location/Qualifiers
FT   CDS_pept        1208179..1209039
FT                   /codon_start=1
FT                   /gene_family="HOG000048983" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259054"
FT                   /orf_name="AFUA_4G04300"
FT                   /product="Alanine racemase family protein, putative "
FT                   /protein_id="EAL84577.1"
FT                   /db_xref="HOGENOM:HBG001447"
FT                   /db_xref="HOGENOM:HBG289671"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniParc:UPI00005201FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9N6"
FT                   /transl_table=1
FT                   /translation="MTPTEQQEQEQPSPTSTTIMPASPSRTGTLLANLSSVTSRISTAA
FT                   LNANRPATKPIRLIAVSKLKPAADILALHNPPTNHLHFGENYLQELLEKSKLLPPSIRW
FT                   HFIGGLQSNKCVTLARDVRGLWAVESVDSEKKASLLDRGWGERSEEVRGVALEDRLRVF
FT                   VQVNTSGEENKAGVDPVAGAVPLARFIREKCPRLKLQGVMTIGAIARSKATTPETENED
FT                   FVCLRETRDRIVRELGLQGDDAELELSMGMSEDFEGAIKLGSDEVRVGTTIFGERPPKS
FT                   EAKVV"
     atgactccca ccgaacaaca agaacaagaa caaccctccc caacatcaac aacaatcatg        60
     cccgcctcac cttcccgaac aggaaccctg cttgcgaacc tttcgtccgt aacctcacgc       120
     atcagcaccg ccgccttgaa cgccaaccgc cccgccacaa aacctatccg cctcatcgcc       180
     gtctcaaagc tcaagcccgc agccgatatc ctcgccctcc acaacccgcc cacgaaccat       240
     ctccacttcg gcgaaaacta cctccaggaa ctccttgaga aatccaagct cctcccgcca       300
     agtatccgct ggcacttcat cggcggactg cagtcgaaca agtgcgtcac acttgcgcgg       360
     gacgtccgcg ggctctgggc cgtcgagtcc gtcgacagcg agaagaaggc ctcgctgctg       420
     gatagagggt ggggggagcg atcggaggaa gtccgtggtg ttgcactcga ggaccggctg       480
     cgtgtgtttg tgcaggtgaa cacctccggc gaagagaaca aggccggggt ggaccctgta       540
     gctggggcgg tgccgcttgc gcggttcatc cgggagaagt gcccacggtt gaagctgcag       600
     ggcgtgatga ctattggggc gattgcgcgg tccaaggcta cgacgccgga gacggagaat       660
     gaggattttg tgtgtttgcg ggagacgcgg gatcgcatcg ttagggagct ggggctgcag       720
     ggtgatgatg ccgagctgga gctgagtatg ggcatgagtg aggactttga gggcgcgatc       780
     aagctgggga gtgatgaggt tcgtgtcggg acgacgattt tcggggagcg gccgcccaag       840
     tccgaggcaa aggtggtgta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page