(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE317

ASFUM1_4.PE317       Location/Qualifiers
FT   CDS_pept        join(complement(1233631..1233657),
FT                   complement(1233534..1233574),complement(1233449..1233461),
FT                   complement(1233275..1233382),complement(1233179..1233221),
FT                   complement(1233048..1233119),complement(1232926..1232976),
FT                   complement(1232674..1232752),complement(1232544..1232613))
FT                   /codon_start=1
FT                   /gene_family="HOG000170540" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259057"
FT                   /orf_name="AFUA_4G04355"
FT                   /product="PaaI_thioesterase family protein, putative "
FT                   /protein_id="EBA27194.1"
FT                   /db_xref="HOGENOM:HBG749290"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI0000F51A76"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA79"
FT                   /transl_table=1
FT                   /translation="MTTLRFVRSVWESFRATSGLEPRLLDNYRTSVSGYTNSRSQLRVT
FT                   AARPGTVNFELDIQKEHTNRLSILHGGTIASMVDLGGSLAVASRGLFATGVSTDLNVTY
FT                   LSSGGKVGDKIQAVLGKTLAYTNIKFMNSKGEVFARGSHTKYIALAWKDPKNIVEELDG
FT                   RKES"
     atgacaacct tgcgatttgt cagatctgtc tgggagtcct tccgggctac ctcagggtta        60
     gagcctcgcc tccttgacaa ttatcggaca agcgtttcgg gatatactaa tagccgctct       120
     cagctccgag taactgctgc acgacctgga actgtcaact ttgagcttga tatccagaaa       180
     gagcacacga atagactcag catccttcat ggagggacaa tagctagtat ggtggacctt       240
     ggcggctccc tagctgtcgc ttctcgaggc ttgtttgcga caggtgtctc gacagatctt       300
     aatgtaacat acctgagctc cggtggtaaa gttggagaca agatccaagc ggttcttggg       360
     aagactctag catacacaaa catcaagttc atgaactcca agggtgaggt cttcgcaaga       420
     ggaagtcata caaagtacat tgctcttgcc tggaaagacc ccaaaaacat tgttgaggaa       480
     ctcgatggac gcaaggaatc gtag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page