(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE320

ASFUM1_4.PE320       Location/Qualifiers
FT   CDS_pept        complement(1238344..1239306)
FT                   /codon_start=1
FT                   /gene_family="HOG000251511" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750015"
FT                   /orf_name="AFUA_4G04380"
FT                   /product="Phenazine biosynthesis-like protein, putative "
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL84585.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG437425"
FT                   /db_xref="HOGENOM:HBG563743"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniParc:UPI000052041C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M8"
FT                   /transl_table=1
FT                   /translation="MTEQVRFVTLDVFTSRPYAGNPLAVVFLPDSNKPAVTQQQKQSIA
FT                   REFNLSETIFVHSEKGEKRIIDIFTPDSELPFAGHPTIGAACWFLYLSPDEGDKGVVKT
FT                   LTTKSGDIPISLQLGQPWPAVTARIAHNTRLHQSRFPLQQLLRLHPFLSGFFRITGTVE
FT                   PAFPIFSIVNGMSQVHVELPSLEALAAVTTASGGEVISGGSGYLDEGWDAGLCVTYFYV
FT                   RNVKDPQTGANTIRTRAIFGNLEDPATGSAASGLAAYLSLMERKPGQYKYNIVQGVEIG
FT                   RRSEIGVEVVVNQDNKIDTVELQGGAVKVSEGNILLPPK"
     atgactgaac aagtccgatt tgtcactttg gacgtcttca cgtcacggcc gtatgctggc        60
     aatccactag ccgtggtgtt cctcccggac tcaaacaagc cggctgtgac acaacagcag       120
     aagcagtcga ttgcgcgcga gttcaacttg tcagagacca tttttgtcca ttctgaaaag       180
     ggagaaaaac gcattatcga catcttcacc cctgacagtg aactcccatt cgcaggccat       240
     cccaccatag gagctgcctg ctggtttcta tatctttccc cggacgaagg agacaaggga       300
     gtcgtcaaga ccctgaccac caagtcgggg gatatcccca tatcgctgca attgggacag       360
     ccctggcctg cagtaactgc tagaatcgcg cataatacac ggctgcacca gtccagattt       420
     ccgctccagc aactgctccg attgcaccct ttcttgtctg gctttttccg tataaccggt       480
     accgtggagc cagctttccc catcttctct atcgtcaatg ggatgagcca ggtccatgtc       540
     gagctgccct ccctcgaggc tctcgctgct gttaccacgg cctcgggtgg tgaggttatc       600
     tctgggggct ctggctatct ggatgaaggt tgggatgcag gtctctgtgt gacgtacttc       660
     tacgtacgca atgtcaagga cccacagact ggtgcaaata ctattcggac cagggcgatt       720
     ttcggaaacc tagaagatcc agcaacagga agtgcggcca gcggtctcgc ggcttatctg       780
     tctttgatgg aaaggaaacc tggtcagtat aaatacaaca ttgtgcaagg ggtggagatt       840
     ggcagacgca gtgagattgg ggtagaggtt gtggtcaacc aggataacaa gatcgacact       900
     gttgagcttc agggaggcgc tgtgaaggta tccgaaggaa acattctact gcctccgaaa       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page