(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE323

ASFUM1_4.PE323       Location/Qualifiers
FT   CDS_pept        join(complement(1246136..1246440),
FT                   complement(1245557..1246081),complement(1245330..1245501))
FT                   /codon_start=1
FT                   /gene_family="HOG000170497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260028"
FT                   /orf_name="AFUA_4G04415"
FT                   /product="IBR domain protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL84589.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054446"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000051F187"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9M4"
FT                   /transl_table=1
FT                   /translation="MPSITLSSFISGLIHSRAEEERLHASDVEKIAPLGAASDKKAIST
FT                   GARRAASRRNMDVRPAPGKSDLHLQAHIAGLKNLCVFPRLGVIDNMARLYQGIRKKERC
FT                   TVCFNSESIKNVEILPCQHIYCDYCFSRLALTAMANEQLFPPRCCSQMIPTEQVLSKLT
FT                   EKEKALFKLKAREYATSARERRYCPAMKCGKWIPLEKLEGQSTTQLCPYCGTAICPGCK
FT                   DKAHAPGKCSFDPGLTEFLELARTQGWQRCFHCGAMVELNEGCPRITCRCGADLCYNCG
FT                   GPWLICHHNALGNVIAECQTGAPLGDGMGTHDAVELAAIVAAMKFAERELEE"
     atgccttcta tcactctatc atcttttatt tccggcctca ttcatagccg agctgaagag        60
     gagcgactgc atgctagtga tgttgaaaag atagctccat taggagctgc ttcagacaag       120
     aaagcaatat ccacaggcgc tcgtcgtgca gcaagcaggc gcaatatgga tgttcgccca       180
     gcgcccggga agtctgattt gcacttgcaa gcccatatcg ctggtctgaa gaacctttgt       240
     gttttcccaa gacttggtgt cattgacaat atggcgcgcc tttaccaagg aatacgaaag       300
     aaggaacgtt gcacggtctg ctttaacagc gaatctatta aaaatgtgga gattctccct       360
     tgccagcaca tatactgcga ttattgtttc agccgattgg cactcacagc catggcaaac       420
     gagcagttgt ttccgccgag gtgctgctcg cagatgattc cgacggagca agtcctctcg       480
     aaactgacag agaaggagaa agcccttttt aagctgaaag cgcgggagta tgcgacatcg       540
     gccagagaac gccggtattg ccccgcgatg aaatgcggga aatggatacc acttgagaag       600
     ttggaaggtc aatcaacgac acagctctgc ccgtattgtg gcactgccat ctgcccgggc       660
     tgtaaggaca aggcacatgc gcctggcaaa tgttccttcg accctgggct gactgaattt       720
     ctcgaactcg cgaggactca aggctggcag agatgttttc actgtggggc gatggtcgag       780
     cttaatgagg gctgcccacg tataacttgt agatgcggtg cagatctttg ctacaactgt       840
     ggtggaccat ggcttatctg ccatcacaac gccttaggga acgtaatcgc cgaatgccaa       900
     accggcgcgc ctctcggaga cggaatggga acacatgatg cagttgaact tgctgctatc       960
     gtggctgcaa tgaaattcgc cgagagagag ctggaagaat ag                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page