(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE328

ASFUM1_4.PE328       Location/Qualifiers
FT   CDS_pept        join(1258062..1258098,1258152..1258198,1258334..1258492,
FT                   1258632..1259069)
FT                   /codon_start=1
FT                   /gene_family="HOG000170452" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260030"
FT                   /orf_name="AFUA_4G04460"
FT                   /product="60S ribosomal protein L13 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL84594.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG211060"
FT                   /db_xref="HOGENOM:HBG601563"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniParc:UPI0000F51AA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L9"
FT                   /transl_table=1
FT                   /translation="MNRLFTRHGNPDYFHKDWQRRVRVHFDQPGRKHRRREARLAKAAA
FT                   VAPRPVDKLRPVVRCPTVKYNRRVRVGRGFTLAELKEAGIPKKLARTVGIAVDHRRVNY
FT                   SKESLVANVARLKDYKARLILFPRKSGQFKKLDSSADEVNAAKAAFAAEGKTEGYATKL
FT                   GATFPVKNISAAEAVTEVKRDELPKGEEAAYRRLREARSEARYKGIREKRAKAKAEEES
FT                   AAKK"
     atgaaccgac tctttacaag acatggaaat ccagactact tccacaagga ctggcagcgt        60
     cgtgtgcgcg tgcacttcga ccagcctggc cgcaagcacc gccgtcgtga ggcccgtctc       120
     gctaaggccg ccgctgttgc tcctcgtccg gttgacaagc tgcgtcccgt tgtgcgctgc       180
     cctaccgtca agtacaaccg ccgtgtccgt gtcggccgtg gcttcaccct tgctgagctg       240
     aaggaagctg gtatccccaa gaagctcgct cgcactgtcg gtatcgccgt tgaccaccgc       300
     cgcgtcaact actccaagga gtcgctcgtt gccaatgtcg ctcgtctcaa ggactacaag       360
     gctcgcctga tcctcttccc ccgcaagagc ggtcagttca agaagcttga ctcatccgcc       420
     gacgaggtca acgccgccaa ggctgctttc gccgctgagg gcaagactga gggttacgcc       480
     accaagctgg gcgctacctt ccccgtcaag aacatctccg ccgctgaggc cgttactgag       540
     gtcaagcgcg atgagctgcc caagggcgaa gaggccgctt accgccgcct gcgggaggcc       600
     cgcagcgagg cccgctacaa gggcatccgg gagaagcgtg ccaaggccaa ggctgaggag       660
     gagtctgctg ctaagaaata a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page