(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE333

ASFUM1_4.PE333       Location/Qualifiers
FT   CDS_pept        join(complement(1270710..1270795),
FT                   complement(1270457..1270622),complement(1270030..1270400),
FT                   complement(1269087..1269966))
FT                   /codon_start=1
FT                   /gene_family="HOG000217275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260034"
FT                   /orf_name="AFUA_4G04510"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL84599.1"
FT                   /db_xref="HOGENOM:HBG054455"
FT                   /db_xref="HOGENOM:HBG327508"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000051EA5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L4"
FT                   /transl_table=1
FT                   /translation="MEFVDPNSDEQEIITRLQNLRAKPARRRLFRQLVHQLASDEWRDL
FT                   RDLLNKRTFKCDILGLLPPEIAVQVAQYLDLAEIHVLQRVSRTWHKLLSSNPVCSAVYR
FT                   RYSGRTLDLFHQASRHIYNQYAKQRIRLERGEPSSALRRREPSHISPACLDYSNGRYAW
FT                   TGEMTTVVVQDMCSHAMQMFCTENRERIGHIRLSDMIVAAVTLRGYCHVWNLQTEESAY
FT                   FRLPSRLFHLFAVRGTKVAFGFKDPAAGNTVVMQWDFNSRVSRTVVVADHLVFIDLHPT
FT                   LDCLISIHLQRNDGVDGPWDLEGVPCNATQLQVVKHYPDDSVGAPQTASKSIALPRLED
FT                   NDWVVRPNAWLSDQFNDRVGILIARPKGSKDHHPHYIIAITYYIETEEVFLHLLPPEHT
FT                   FSSHLHLAPVDRNLLYYIRVEGAMPTIWISQPGAQVPYRPAKSMPSPWAVDPGQHDADE
FT                   YVLKGDHDCVLLLNRGGVSAWCFDEAAQPLRAIPFQLPENRR"
     atggaatttg tagacccgaa ttcggacgaa caagagatca tcactcgact ccaaaatctc        60
     agggcaaagc ccgcgcgacg cagactgttc cgtcagcttg tccatcagct agcttctgac       120
     gaatggcgtg acttgaggga tcttctcaat aaacgaacct tcaagtgtga tatcctaggg       180
     ttgcttccac ccgagattgc tgtgcaagtc gcccagtatc tagacctagc ggaaatccat       240
     gttttgcaga gagtctctag aacttggcac aagctcctgt catctaaccc agtctgcagc       300
     gctgtatacc gtcggtattc aggccgcacc ctcgatcttt ttcatcaggc atctcgtcac       360
     atctacaacc agtatgccaa gcagagaatc agactggagc gaggagagcc gtcttcagcc       420
     ctccgtcggc gcgagcccag ccacattagc ccagcatgtc tagactattc gaatggacgg       480
     tatgcatgga ctggcgaaat gaccacagtc gtcgtgcagg atatgtgttc gcatgcaatg       540
     cagatgttct gcactgaaaa cagagaacgc atcggccaca ttcgtctttc ggatatgatt       600
     gttgcagcgg tcactctacg tggatactgc cacgtctgga atctccaaac ggaggaatca       660
     gcatactttc gactgccatc ccgcctattc cacctcttcg ctgttcgcgg caccaaggtt       720
     gcctttggtt tcaaggaccc cgcggctgga aacaccgttg tcatgcaatg ggacttcaac       780
     tcgcgtgttt cccgcacagt agttgtggca gatcacttag tgtttataga cttacatcct       840
     acgctggatt gcttgatctc catccatcta cagcgaaacg acggcgttga tggtccatgg       900
     gatctcgaag gggtcccatg caatgccaca cagttgcagg tcgtcaaaca ttaccctgat       960
     gattcggtgg gagctcctca aaccgcgtcc aaaagtatag ccttgccaag gctagaagat      1020
     aacgactggg tagttcggcc aaatgcctgg ctctcagacc aattcaacga cagagtggga      1080
     atcctaatag cccgtcccaa gggcagtaaa gatcaccacc cacattatat tatcgccatt      1140
     acctactata tcgagactga agaggttttc ttgcatctct tgcccccgga acacacattc      1200
     tcctcccact tacaccttgc acctgtcgac cgcaatcttt tgtactatat cagggtcgag      1260
     ggagccatgc ccaccatctg gatttcacaa ccaggcgcgc aagttcctta ccggccggcc      1320
     aagtccatgc cttctccatg ggcggtagac cctggtcaac atgatgccga cgaatacgtg      1380
     ctcaaaggag atcatgattg tgttttgttg ctgaataggg gtggtgtgag cgcgtggtgt      1440
     ttcgatgaag ccgcacagcc attgcgtgct attcctttcc aactcccgga gaatcggaga      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page