(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE334

ASFUM1_4.PE334       Location/Qualifiers
FT   CDS_pept        join(complement(1273294..1273350),
FT                   complement(1273118..1273201),complement(1272983..1273055),
FT                   complement(1272822..1272921),complement(1272204..1272749),
FT                   complement(1272096..1272142),complement(1271752..1272044),
FT                   complement(1271548..1271682))
FT                   /codon_start=1
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206591"
FT                   /orf_name="AFUA_4G04520"
FT                   /product="Succinyl-CoA synthetase beta subunit, putative "
FT                   /EC_number="6.2.1.4"
FT                   /function="ATP binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /function="succinate-CoA ligase (GDP-forming) activity "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="EAL84600.1"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0004776"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="HOGENOM:HBG130207"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI000051F64D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L3"
FT                   /transl_table=1
FT                   /translation="MFKLARSSRPVAAAIRAATESSVQFRLAQQQRNLSIHEYLSARLL
FT                   KSYGVGVPKGEVAHSAEEAEAVAKSIGNDDMVIKAQVLAGGRGKGSFDNGLKGGVRVIY
FT                   SPTEAKMFASQMIGHKLITKQTGAAGRLCNAVYICERKFARREFYLAVLMDRATQTPVI
FT                   VASSQGGMDIEAVAKEHPEAIMTTPIDIKVGVTDDIARKIATDLGFSEQCIEDAKTTIQ
FT                   NLYKVFMEKDATQIEINPLSETSDHQVLAMDAKLNFDDNAEFRQKEVFSWRDTTQEDAD
FT                   EVKAAEYGLNFIKLDGDIGCLVNGAGLAMATMDIIKLNGGNPANFLDVGGGATPAAIKS
FT                   AFELITSDPKVTAIFVNIFGGIVRCDAIARGLINVVEDMGLRIPIVARLQGTNMEQAQK
FT                   LINESGLKIFSIEDLQSAAEKSVQFSKVVKMAREIDVGVEFTLGI"
     atgtttaagc tcgcgcgaag cagccgtcct gtcgctgcag ctatcagagc tgcgacggaa        60
     tcctccgtcc aattcagact ggcccagcaa cagagaaacc tgtccattca cgaatacctc       120
     tctgccagac tgctcaaatc ctatggcgtc ggagttccca agggtgaggt cgcccactcg       180
     gcagaggaag cagaggctgt cgctaagtca atcgggaacg atgacatggt gatcaaggct       240
     caagttcttg ctggtggccg tggtaagggt tccttcgaca atggtcttaa gggaggtgtg       300
     cgcgttatct actccccaac cgaggccaag atgttcgcta gccagatgat cggacacaag       360
     ctcatcacca agcagactgg tgctgctggt cgcctttgca acgctgtcta catttgcgag       420
     cgcaagttcg ctcgtcgtga attctatctt gccgtcctca tggaccgcgc aactcagacc       480
     cccgtcattg ttgcctcgtc gcaaggcggt atggatattg aggcagttgc caaggaacac       540
     cctgaggcta tcatgacgac tcctattgac atcaaggttg gcgtgactga tgacattgcc       600
     cgcaagattg ctaccgatct tggcttctct gagcagtgca tcgaggatgc caagacaacc       660
     atccagaacc tgtacaaggt cttcatggag aaggacgcta ctcagattga gattaaccct       720
     ctgtctgaga cctccgacca ccaggttctg gctatggacg ccaagctgaa ctttgatgac       780
     aacgctgagt tcagacagaa ggaagtcttc tcgtggagag acactactca ggaagacgcc       840
     gatgaggtca aggctgctga gtacggcttg aacttcatca agctggatgg tgacattgga       900
     tgcctggtca acggtgctgg tctcgccatg gccaccatgg atatcatcaa gctcaacggc       960
     ggaaaccccg ccaacttcct cgacgttggt ggtggtgcta cccccgccgc tatcaagtct      1020
     gcttttgagc tcatcaccag cgacccaaaa gtcactgcca tcttcgttaa cattttcggc      1080
     ggtatcgtcc gctgcgatgc tatcgcccgg ggtttgatca atgtcgtgga ggatatgggt      1140
     ctgcgcatcc ccatcgttgc tcggttgcag ggtaccaaca tggagcaggc tcagaagctg      1200
     atcaacgagt ccggtcttaa gatcttctcc atcgaggacc tccagagcgc cgccgagaag      1260
     tccgtccagt tctccaaggt cgtcaagatg gcccgtgaga ttgacgtcgg tgtcgagttc      1320
     accctcggta tctaa                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page