(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE336

ASFUM1_4.PE336       Location/Qualifiers
FT   CDS_pept        join(1276853..1277556,1277612..1277960)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260035"
FT                   /orf_name="AFUA_4G04540"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein, putative"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84602.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054456"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniParc:UPI0000520429"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9L1"
FT                   /transl_table=1
FT                   /translation="MVYSAAAILPISIYLQIITHASNRVIVCACVYRLIRNNVDQYFSV
FT                   RSRGYRTLAKSCRRCVILDRCGSCSDPLCRYLPATVCDILLAHYMMECSPCLRWSTQTF
FT                   TIAQMTPIWIFPAYPMLIIGPHAGILSAKLEPSRALPIIIGGTTIQGIGLLVTLTVYSA
FT                   YVYRLFSQKLPRENLRPGMFVSVGPSAFTVSGLVTMAAHAKRCFPDDFMGNGALAANIL
FT                   EVVVNFACLWLWGLAIFFFFIATFAHWSTIGPGRMNFSMAWFSFVFPNTALITATFAIG
FT                   NAFSCKPILIIGCAMIFPLILMYIFVFYMMIRAIVLRQIMWPQKGEDKDEGGFEINRTK
FT                   PETPGEQTPV"
     atggtgtatt ctgctgctgc gattctacct atatccatat accttcaaat tatcactcac        60
     gcatccaaca gagtcattgt ttgtgcctgc gtctatcgtc tcattcggaa caatgttgat       120
     caatatttct cagtacggtc cagaggctac aggaccttgg ctaagtcatg ccgtcggtgt       180
     gttattttgg atcgatgcgg ctcttgcagt gatcctctct gccggtatct acctgctact       240
     gtatgtgaca ttcttcttgc tcactatatg atggaatgct caccttgcct taggtggtcg       300
     actcagacgt tcacgatagc ccaaatgaca cctatatgga tcttcccggc gtaccctatg       360
     ttgataatag ggccccatgc aggaatccta agtgcaaaac ttgaaccttc tcgggcctta       420
     cccatcatca ttgggggaac aactatacag ggaatagggc tgctagtaac ccttaccgtt       480
     tactcggcct atgtctacag actttttagt cagaaattgc ctagggaaaa tttgcgtccc       540
     ggaatgtttg tctctgttgg tcccagtgcc ttcactgtct caggacttgt gaccatggct       600
     gcccatgcaa agcgatgctt tccggatgac tttatgggca acggcgccct ggctgcgaat       660
     atcctcgaag tggttgtcaa tttcgcttgt ctgtggctct ggggcctggc gatatttttc       720
     ttttttattg ccacttttgc ccactggtca accatcggcc ctggcagaat gaatttttca       780
     atggcatggt tctcatttgt cttccccaac actgccctga tcaccgccac gttcgccatt       840
     gggaacgctt tctcatgcaa gccgattctg atcataggct gcgccatgat ttttcctctc       900
     atactaatgt atatctttgt cttttacatg atgattcgag ccatcgtgtt acggcaaatt       960
     atgtggccac agaagggcga ggacaaggat gagggtggat ttgagattaa tcgaaccaag      1020
     cccgagaccc ctggtgaaca gactcctgta taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page