(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE338

ASFUM1_4.PE338       Location/Qualifiers
FT   CDS_pept        join(1281588..1281939,1282186..1282302,1282535..1283763)
FT                   /codon_start=1
FT                   /gene_family="HOG000170376" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206592"
FT                   /orf_name="AFUA_4G04560"
FT                   /product="GTP binding protein, putative "
FT                   /function="binding"
FT                   /protein_id="EAL84604.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054457"
FT                   /db_xref="HOGENOM:HBG327466"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F889"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K9"
FT                   /transl_table=1
FT                   /translation="MISDNEPDMVHTTGPDTEDQLAKETSSKAQNDIDCPSLGQILSQL
FT                   SPPPSTLPVQTLSLVPVDEQEVLLRRLEDVLAEATGGAESFEEVQTILNELWKCQSSYL
FT                   AQAADALANGSRNDENRALVVKGNYTAAILNRLSPELVHVVIPVIYNISIDYEQGIRES
FT                   PGGTILLLLDLLSEEGVALSQFVGLANCLMSYLDKERFQDICISQCMVDRVLSVLKQSL
FT                   YIKADPSSNGDTKALAQLQLKINQTLSEVSASPKFSEVYPLGSPLVQTLKDWLASTEDQ
FT                   LQICSCVMLGNLARSDAVCEIMVRKMNIHTMLISILRSDARGAVLHSALGILKNLAIAG
FT                   ENRQSLGDARIIPAVSRLWGYETVPQVQFAATSIVRQVIISSTANISCLLGLAPIDEDS
FT                   SASGQTYLSSLLSLCEKTDSTPIKTEVGRIVASICRTIVPKSREADSEASTLLERLFTM
FT                   HQSVALPLGAMIAQSQWPVVRSEGWFALALMASSKHGTGAVIDCLQKLDLYPLLEETMS
FT                   TPVSDSADDADKLKAAKDRDNIVVLIQELLKNDVSQKQFSSPISAGVY"
     atgatcagcg acaacgagcc ggatatggtt cacacgactg gacctgatac tgaagaccaa        60
     ttggcgaagg agacatccag caaggcacag aatgacatag actgtccttc gttgggacag       120
     atattgtcac aattgagtcc cccaccgtca actctaccgg tgcagacact ttctttggtc       180
     ccagttgacg agcaagaggt tcttttgcga cgcttagaag atgtgcttgc agaggctaca       240
     ggtggtgctg agagctttga ggaagtgcag accattctaa atgagctctg gaagtgccag       300
     tcgagctacc tggcgcaagc agctgatgcg ctggcaaacg ggagtagaaa cgatgaaaac       360
     agagcccttg ttgtcaaggg taactataca gctgccattc tcaaccgtct tagcccagaa       420
     cttgtgcatg tcgtgattcc tgttatctac aacatctcca tcgattatga acaaggaatc       480
     cgagaatcgc caggggggac aattctactt ctcttggacc ttttgtctga ggagggcgtt       540
     gctctctctc aatttgttgg ccttgctaat tgtcttatgt cttatttaga caaggaacga       600
     ttccaggata tttgtatcag ccaatgtatg gttgaccgag tgttatccgt gctcaaacag       660
     tcattatata tcaaagcaga cccttcatca aatggtgata ccaaagcatt ggcgcagcta       720
     cagctgaaga tcaaccaaac actttcagaa gtctctgcat cacccaaatt ctccgaggta       780
     tatcccctcg ggtctcccct tgttcagacc ttgaaagatt ggctggcttc cacggaagac       840
     caacttcaaa tctgttcgtg tgtgatgctg ggcaacttgg ctcgatcgga cgcagtgtgc       900
     gaaattatgg tgcggaagat gaacatacac actatgttga tatcgattct gagatctgat       960
     gctagaggcg cggttctcca ttctgcactt ggaattctga agaatttggc gatagctgga      1020
     gagaaccgac aatctttggg cgatgctagg attattcctg cagtctcacg cctatgggga      1080
     tatgagacgg ttcctcaagt ccaatttgct gcaacaagca ttgttcggca agtcatcatc      1140
     tcatcgaccg cgaacatttc gtgtctgctg ggacttgctc ctattgatga ggactcctcg      1200
     gcctctggac agacatatct ttcatcttta ctctctctgt gtgagaaaac ggactccaca      1260
     ccaatcaaaa cggaggttgg acggatcgta gcttcaattt gccgcacgat tgttccaaag      1320
     tctcgcgaag cggacagtga ggctagcact ctccttgagc gtctgttcac tatgcaccag      1380
     agtgtcgcgc ttccacttgg agctatgatt gctcaatcgc aatggccagt ggtcaggagc      1440
     gagggctggt tcgccttggc tttgatggct tccagcaaac atggcactgg cgccgttatc      1500
     gactgcctgc agaagctgga cctatacccg ttattggagg agacaatgag cacacctgtt      1560
     tctgactcgg cggatgatgc ggacaaattg aaggcagcca aggatcgcga taatatcgta      1620
     gttcttattc aagaactgct gaaaaacgat gtaagtcaaa agcagttctc ttctccaata      1680
     tctgcgggcg tttactaa                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page