(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE340

ASFUM1_4.PE340       Location/Qualifiers
FT   CDS_pept        join(1285670..1285763,1285869..1285954)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260037"
FT                   /orf_name="AFUA_4G04580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84606.1"
FT                   /db_xref="HOGENOM:HBG054459"
FT                   /db_xref="UniParc:UPI000051F3EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K7"
FT                   /transl_table=1
FT                   /translation="MYRNSEMTARAGSGNNGGNLEVGGWKRQGVEYYLWFYLINHHDEG
FT                   RGGLVPDPVLPMTS"
     atgtacagga atagcgagat gacagcccgc gccggaagcg gtaataatgg tggtaatcta        60
     gaggttggtg ggtggaaacg ccagggtgtg gaatactacc tctggttcta tctcatcaat       120
     caccatgacg agggaagagg aggacttgtt cctgatccgg tgctgccgat gacgtcgtga       180
//

If you have problems or comments...

PBIL Back to PBIL home page