(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE345

ASFUM1_4.PE345       Location/Qualifiers
FT   CDS_pept        join(1295892..1296008,1296089..1296205,1296301..1296487,
FT                   1296542..1297755)
FT                   /codon_start=1
FT                   /gene_family="HOG000170308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260040"
FT                   /orf_name="AFUA_4G04620"
FT                   /product="Mitochondrial outer membrane protein (Sam50),
FT                   putative"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="EAL84610.2"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG060099"
FT                   /db_xref="HOGENOM:HBG756550"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI0000F51AA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K3"
FT                   /transl_table=1
FT                   /translation="MASFSPPGASRGQPKRTVRGLLAIAAAEMSSPLSAEDEDIFERLQ
FT                   QRADPKVLEEQQQAINERVHAIYQKAQMRLGELIDQNSTLPCAISSVQVLNATHTRRSF
FT                   LQSIFDPLLSVNQSRPYTLSEALREISSRADKLGKFDIFQQPISVYIDQSQDAKSQNGI
FT                   PNIDVFFSVKEKSRVLLKTGTDLGNTEGSAYGNLLWRNVFGGAETLNLNAAMGTRTRSA
FT                   YQAAFETPILSDPDFRFELGGIASSTQKSWANHEEVLKGGWSKLRWLSQSGHRHEIGYN
FT                   GFWRQVTGLAENASPTVRADAGDSVKSSIFHSWVADRRDNPLLPSRGYYAKAFNELAGW
FT                   GPLKGDVSFWKSEVEAQGAIPIPIPGIKGDSGISFTTGFRAGLLYPLGLDSDSRPQLSR
FT                   INDRFVLGGPTDVRGFRLCGLGPHDGADAVGGDVYAAGSANLFLPLPRVGADKPLRLQA
FT                   FVNGGRLLPLRTLQKEAPTNSTEVKDAMTATISELGNGLPSVAAGIGLVYAHPVARFEL
FT                   NFSLPLVLRKGEEGRKGLQLGIGINFL"
     atggcttcat tctcgccgcc gggagcatct agagggcaac cgaaaaggac tgtacgaggt        60
     ctcttggcca ttgcagccgc agaaatgtcc tcgccactct ctgctgaaga tgaagacatc       120
     ttcgagcgtc tccaacagcg agccgacccg aaagtactcg aagagcagca acaggccatc       180
     aacgaacgag ttcatgctat ctaccagaag gcgcagatgc gtcttggaga gctgattgac       240
     cagaactcaa ctcttccatg cgcgatatcg tcggtccaag tgcttaatgc gactcataca       300
     cgcagaagct tcctgcaatc tatattcgac ccactcttaa gcgtcaatca atcacggccc       360
     tatactctct ctgaggcgtt gcgagagatc tcgtcccgtg ctgacaagct cggaaaattc       420
     gatatctttc agcaaccgat ttcagtgtat atcgaccagt cacaagatgc gaagtcgcaa       480
     aacggaatac ccaacatcga tgtctttttc tctgttaagg aaaagtcccg tgtactcctg       540
     aagacaggaa ctgaccttgg aaacactgaa ggctcggcct atggaaatct cctctggcgc       600
     aatgtttttg gtggtgcaga gaccctcaat ctgaatgctg ctatgggcac caggacaagg       660
     tctgcctatc aagctgcttt cgaaaccccc attcttagcg atccggattt ccgcttcgaa       720
     cttggtggta ttgcgagttc aacgcaaaag tcctgggcga atcatgaaga agtgctgaag       780
     ggtggctgga gtaagctccg ctggcttagc caatccggtc atcgccatga gatcggatac       840
     aatggcttct ggagacaggt tactggactg gctgagaacg cgtcgcccac ggtccgggct       900
     gatgcagggg acagtgtgaa gagcagtatt ttccacagct gggtcgcaga tcgaagagat       960
     aaccctctcc ttccatcccg tggttactac gccaaagcct tcaacgaatt ggccggatgg      1020
     ggtcccctga agggagatgt ctcgttttgg aagtcggagg tcgaagccca gggagcaatt      1080
     cccattccaa ttcccggaat taaaggtgac agtggtatca gcttcacaac cggtttccgt      1140
     gcaggtcttc tgtatccttt ggggctggac tctgattccc gacctcagct atctcgcatc      1200
     aatgaccgct tcgtacttgg aggcccgaca gacgtccgcg gcttccgcct ctgtggactc      1260
     ggtcctcacg atggagccga tgctgtagga ggtgatgtgt atgctgcggg tagtgcaaat      1320
     cttttcctgc ctcttccccg agtcggtgcg gacaagccgc tgcggctgca ggcgttcgtg      1380
     aacggtggcc gcctgctacc cctgcgcact ttgcagaagg aggctccaac aaacagcaca      1440
     gaggtgaagg acgccatgac tgctacgatt tcagagctag ggaatggact gcctagtgtt      1500
     gcagcaggca ttgggctcgt gtacgcccac cctgttgcgc gatttgagct gaacttctcg      1560
     ctcccactgg tgttgcggaa gggtgaggag ggcagaaagg gactgcagct cggaattggt      1620
     atcaacttcc tgtag                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page