(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE346

ASFUM1_4.PE346       Location/Qualifiers
FT   CDS_pept        join(1298065..1298415,1298510..1299112)
FT                   /codon_start=1
FT                   /gene_family="HOG000037706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750019"
FT                   /orf_name="AFUA_4G04630"
FT                   /product="Golgi membrane protein, putative "
FT                   /protein_id="EAL84611.1"
FT                   /db_xref="HOGENOM:HBG191785"
FT                   /db_xref="HOGENOM:HBG611223"
FT                   /db_xref="UniParc:UPI000051FFD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K2"
FT                   /transl_table=1
FT                   /translation="MAQYYPQQQPYGSQASPQNLQFYPSSYTSVSGHTTPSQATYGGFG
FT                   GPSGSTAQAYPVGGVGSGYGGFGSPAAGVSGRMGEQGGLRTGWLAAFGTEGYEGEPPLL
FT                   EELGVNFEHIRTKTLTVLNPFARIDQHLMDDSDLYGALLYIVLYGTFLLLSGKVFYGYI
FT                   YGVAVFGTVVLHLILSLMSPALDTASAPNAADPSNYDPHHKPTMSDASSVGHFSATLTF
FT                   PRSASVLGYCFLPLVLTSLVGILIPMDTLFGYLLTTAAVGWCTYSSSGMFCAVARMRGM
FT                   RGLVAYPLALFYVVFGIMGIFSSRGSGTLAAKTGAA"
     atggcccaat actatcccca gcaacagccc tacgggtcgc aagcctctcc gcagaatctc        60
     caattttatc cgtcatcata cacgtcggtc tcaggtcata caacgccatc gcaagctacc       120
     tatggtggat ttggcggacc ttcgggctcc actgctcagg catatcccgt tggaggggtc       180
     gggagcggat atggtggctt tgggtcccct gccgctggag tgagtgggag gatgggtgaa       240
     cagggcggat taaggacagg atggctggct gcttttggca cggagggcta tgaaggggag       300
     ccgccgctgc tggaggagct gggtgtgaat tttgagcata tcaggaccaa gactttgaca       360
     gtgctcaacc cttttgctcg gatcgatcag catctgatgg acgacagcga tctgtacggg       420
     gccctccttt acatcgtgct ctacgggaca ttcctccttc tctcgggcaa ggtcttctat       480
     ggctacatct atggtgtcgc cgtctttggt accgtcgtcc tgcacctgat tctcagtctt       540
     atgtcgcctg ctctcgatac ggcgtcggcg cccaatgccg cagacccgtc caactacgac       600
     ccccatcaca aacctaccat gtccgacgcc tcctccgtgg gtcatttctc tgccaccctg       660
     acgtttcctc ggtcggccag tgttcttggt tattgtttcc tgcccttggt tttgaccagt       720
     cttgtgggga ttctgatccc gatggatact ctgttcgggt acttgttaac gacggccgcg       780
     gtcggctggt gcacgtatag ttcctcgggg atgttctgtg ctgtggcccg gatgcgtggt       840
     atgagaggct tggtggcgta cccgcttgct ttattctatg ttgtctttgg catcatgggg       900
     atcttctcgt cccgcggcag tggtaccctg gccgctaaaa cgggcgccgc ttga             954
//

If you have problems or comments...

PBIL Back to PBIL home page