(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE347

ASFUM1_4.PE347       Location/Qualifiers
FT   CDS_pept        complement(1299450..1301837)
FT                   /codon_start=1
FT                   /gene_family="HOG000170297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260041"
FT                   /orf_name="AFUA_4G04640"
FT                   /product="Ubiquitin fusion degradation protein (Ufd1),
FT                   putative"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL84612.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG054463"
FT                   /db_xref="HOGENOM:HBG327424"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI0000520924"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9K1"
FT                   /transl_table=1
FT                   /translation="MAREQDLLQWSSQFFVAAPQRTPKLPGDKITLPQSALEQLLAAAP
FT                   LSDVSPQGSLRQYTSTFDPFNPHTFAAESRARAQQLDRQKQLPHPLTFRLVNPNNERAI
FT                   YAGIREFSAAEGEVGLSGFLRQALDIEDEPFQLQTGEHGTETAHSPDLNNREGSGSVRS
FT                   TRHSTPTITVHAKQLPKGTYVRLRPLEAGYDPEDWKALLERYLRDNFTTLTIGELLSVS
FT                   GNRNERFRFLVDKVEPEGDGICVVDTDLEVDIVALTEDQARETLQRRLEKASRAPGTKG
FT                   GSSIGGVLALGETVTGQVIPGEYVDYELSRWDGEETIEVEVEGIDDAVVYLFASPFSSH
FT                   QRNRPRLDEHVFADFSSQPSKKLRIRPTNIELDGAEALYLSVHAYSQTEAGAGMASSQT
FT                   LPLRYSMRVVQSSSAIQREQTAAQLDTHEPGDVQCKNCHQWVPQRTLVLHENFCLRNNV
FT                   LCPQCGNVFQKRSPEWDNHWHCPHDSSHGNDIPSKDRHDGIFHTRRLCPDCGFEADSLP
FT                   SLAQHRTTVCPEKPILCQFCHLVVPQRGETDPDMLDPEVLLSGLTPHELVDGGRTTECH
FT                   LCNKIIRLRDMKTHLRHHDLERLSRPAPRICLNQNCGRTLDARAAQSTITPGTDTLGLC
FT                   SICFGPLYVDTYDPEGKLLRRRIERRYLSQLMSGCGKPWCQNEYCKTGKQHRLSINTSD
FT                   GGTTSMSVAQILTLVRPLIDAINLRRDAPNTAPFYLCTDQVSQQRRIQAEMIAAEGAMT
FT                   GGKAYDLPWCVAAVEATAGDLDKAREWLTNWAPARDEEQTFC"
     atggctcggg agcaagattt attacagtgg tcatctcagt tcttcgttgc tgcaccacag        60
     cgcacaccga agttacctgg agacaagatt actctgccac aatcggccct cgagcagctt       120
     ctggctgctg ctccgttgag cgatgtatca cctcagggtt ctttgcgcca atacacgagt       180
     acctttgacc cgttcaatcc tcacacattc gccgccgaat cgcgagctcg agcacagcag       240
     ctagaccgcc aaaagcagtt acctcatcca ctcactttcc gactggtgaa ccccaacaat       300
     gagcgtgcaa tatatgcagg gatacgagag ttttcagctg cggagggaga agtgggtctc       360
     agcggttttc tacgacaggc tcttgacatc gaggatgagc cattccaatt gcaaaccggt       420
     gaacatggga cagagacggc gcactctccg gatttgaaca accgagaagg atcagggtct       480
     gttcgctcga cccgccattc aacccccaca attacagtcc atgccaagca gttgccaaaa       540
     ggcacatatg tgcgcctacg ccctctcgaa gctggatacg acccagagga ctggaaagca       600
     ttgctggagc gctatttacg tgacaatttc accactttga ctatcgggga acttctttcg       660
     gtgtccggga atcggaatga acggtttaga tttctcgtcg acaaggtgga acccgaaggc       720
     gacggcattt gcgttgtgga tacagatttg gaggttgata ttgtggcttt gactgaagac       780
     caggcaagag agacattgca aagacggtta gagaaagctt ctcgtgctcc cggcaccaaa       840
     gggggcagct ccattggcgg agttctcgcc ctgggagaaa cagtcactgg acaggtgatt       900
     ccaggcgaat acgtagacta cgaactcagc agatgggatg gcgaggagac gatcgaagtt       960
     gaggttgaag gaatagatga cgcagttgtc tatttgttcg cgagtccatt ctcctcgcat      1020
     cagcgcaatc gacccaggtt ggacgagcat gttttcgccg acttctcaag ccaaccatcg      1080
     aaaaagcttc gtatccggcc aaccaatatt gaactagacg gggctgaggc attgtatctt      1140
     tcggtgcatg catattctca gaccgaggct ggtgccggga tggcatcaag ccagacctta      1200
     ccacttcgtt acagcatgcg ggtcgtgcaa agctcttcag ctattcaaag ggaacagacg      1260
     gcagcccagt tagatactca tgaacctggc gatgtgcagt gtaagaactg tcatcagtgg      1320
     gtgcctcaga ggacgcttgt tctgcatgag aacttttgtt tgcgcaataa tgtgctttgc      1380
     cctcagtgcg gtaatgtctt ccagaagcgc tctccagagt gggataatca ttggcactgc      1440
     cctcacgatt cgtcccacgg taatgatatt cctagcaaag ataggcatga cggtatcttc      1500
     cataccaggc gcttatgtcc tgattgtgga ttcgaagccg acagcctccc gagcctcgct      1560
     caacatcgca cgactgtgtg tccagagaag ccaattctat gtcaattctg tcacctcgtg      1620
     gtaccgcagc gaggggagac ggaccctgac atgctcgacc ctgaggtgtt gttgtccggt      1680
     ctcactccgc atgaattggt tgacggtggc cggacgacag aatgccatct ctgcaacaag      1740
     atcattcgac tccgggatat gaagacgcac ctgcgccacc atgatctcga gcgtctctct      1800
     cgaccggcgc cccgtatctg tttgaaccag aattgtggca gaacgctcga tgcacgagca      1860
     gcacagagca caatcactcc aggaaccgac acgctaggcc tctgcagtat ctgcttcgga      1920
     cctctgtacg tagatacata cgatccggaa ggaaaactac ttcgtcgccg cattgagcgc      1980
     cgatatctct cccagctgat gtcaggatgt gggaagccct ggtgtcagaa tgagtactgc      2040
     aagacaggaa agcaacaccg gctatccatc aacaccagcg atggcggaac gacgtctatg      2100
     agcgttgcgc aaatcttgac cttggtgcga cccctgatag atgccatcaa tctccggagg      2160
     gacgcgccga acactgcacc tttctacctt tgcaccgatc aagtcagcca gcagcgacgg      2220
     attcaggcgg agatgattgc tgctgaagga gctatgaccg gaggcaaggc atatgatctg      2280
     ccatggtgtg ttgctgctgt cgaagcaacc gctggggatc ttgacaaagc acgagagtgg      2340
     ttgacaaatt gggcgcccgc tagagatgag gaacaaacgt tctgttag                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page