(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE349

ASFUM1_4.PE349       Location/Qualifiers
FT   CDS_pept        join(complement(1308694..1308928),
FT                   complement(1307935..1308610),complement(1307578..1307836))
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750021"
FT                   /orf_name="AFUA_4G04660"
FT                   /product="Proteasome regulatory particle subunit Rpt6,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="EAL84614.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000051FFBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J9"
FT                   /transl_table=1
FT                   /translation="MALDNYYRNKIESMKLEIIQGQAVLRRLEAQRNDYNSRVRLLREE
FT                   LGLLQQPGSYVGEVVKVMSTKKVLVKVHPEGKYVVDIADGVDITKLTVGKRVALLSDSY
FT                   KLEKMLPSSVDPLVSLMMVEKVPDSTYDMIGGLDQQIKEIKEVIELGLKHPELFESLGI
FT                   AQPKGVLLYGPPGTGKTLLARAVAHHTDCRFIRVSGSELVQKYIGEGSRMVRELFVMAR
FT                   EHAPSIIFMDEIDSIGSSRIDSAGSGDSEVQRTMLELLNQLDGFEPTKNIKIIMATNRL
FT                   DILDPALLRPGRIDRKIEFPPPSVEARADILRIHSRSMNLTRGINLTKIAEKMNGCSGA
FT                   ELKGVCTEAGMYALRERRVHVTQEDFDLATAKILNKHDDKEVAVSKLFK"
     atggcgctgg acaactacta tcgcaataag atcgagagta tgaaactcga gattatccaa        60
     ggccaggctg ttttacgtcg actggaagca cagcgcaacg actataattc gcgagttcgc       120
     ctactacgag aggagttggg cttgcttcaa caacctgggt cttatgtggg agaggtcgtg       180
     aaggtgatga gcaccaagaa ggttcttgtc aaggtacatc cagaaggaaa atatgtcgtt       240
     gacattgcag acggggtcga tattacgaaa cttactgtgg gcaagcgtgt tgcgttgctt       300
     tcagactctt ataaattaga aaaaatgttg ccatcgtcgg ttgacccgct cgtttcgctt       360
     atgatggtcg agaaggtgcc tgacagcaca tacgatatga tcggaggcct tgatcaacaa       420
     atcaaggaga tcaaggaagt cattgagctt ggtctcaagc atccagaact gttcgagtct       480
     cttggtatcg cacagcccaa aggtgttctt ctttacgggc cgcccggaac cggtaaaaca       540
     ctgctcgccc gagcggtagc ccatcacaca gattgccgat tcatcagggt cagcggctcg       600
     gaactagtcc agaaatacat tggtgagggt agtcgcatgg tgcgtgagct gttcgtcatg       660
     gctcgagaac atgcaccaag cattatcttc atggacgaga ttgacagtat cggttctagc       720
     cgtatagact cggctggctc tggagattca gaggtgcagc gtacaatgtt ggagctgctc       780
     aatcagctgg atgggtttga gcccacaaaa aacatcaaaa tcatcatggc tacgaaccga       840
     cttgatatcc tggatcccgc tttgttgcgg cccggaagga ttgaccggaa gatcgagttt       900
     ccaccgccat cggtggaagc tcgtgccgat attctacgca ttcactcacg gtcgatgaac       960
     ctgacgcgag gcatcaactt gacgaagatt gcagagaaga tgaatggatg ctcaggagca      1020
     gaactgaagg gtgtgtgcac cgaggcaggc atgtacgcgc ttcgggaacg acgagtgcac      1080
     gtcacgcagg aagattttga cctagccact gccaagattc tcaacaaaca cgatgacaag      1140
     gaggttgctg tctcgaaact gttcaagtag                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page