(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE35

ASFUM1_4.PE35        Location/Qualifiers
FT   CDS_pept        join(complement(119040..119894),complement(118224..118955))
FT                   /codon_start=1
FT                   /gene_family="HOG000216778" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273689"
FT                   /orf_name="AFUA_4G00460"
FT                   /product="Chlorohydrolase family protein, putative "
FT                   /EC_number="3.8.1.-"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="EAL84372.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG054160"
FT                   /db_xref="HOGENOM:HBG324149"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI000051EB2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W969"
FT                   /transl_table=1
FT                   /translation="MSTEMLLTKMSTKILLCLQLFLYAGICLAKASILFQDAAAVISFD
FT                   KTSETLRVIRNASVLVTGDTIAAIMPASEHLQRPANTTVIPSDGKIITPGFVDTHRHAW
FT                   QTAFKTLGSNTSLAEYFARYSEFSPAKKIFTPEDVYIGQLTGLYESLNSGVTSILDHAH
FT                   HTWSSETALAGLRASVDSGARTWWCYAFHNLSDATWASNYTREDQIADFLRIAEHGPWR
FT                   KSDTVSLGIAYDNFALEDAAEIEQITSLALYEASSIEIRRADFISGRKTFLHSQYTTLA
FT                   VLGVYNFLNTSIPIVFSHASYLTVKDAELLRSTNQYISITGESERHYGHDHPSSPYIMD
FT                   QSSLGIDTHFTYSADIVGQARMWLQEVRLRLYAQVLDCWDIPPNNPMSVEQAFLLATRA
FT                   GGLALRRPDIGVLVEGAKADLVVFDGTSPNMLGWVDPVAAVILHSNPGDVEHVLVNGEF
FT                   RKRDFKLVVPGNLAEIQQRFLASARRIQEVWKQMPLPVLEGSFPNTPGVNYSKAVTADV
FT                   VRGWQNGYLSS"
     atgagcacgg aaatgcttct gaccaagatg tcaaccaaaa ttcttctatg ccttcagtta        60
     ttcctgtacg ctggcatttg cctagccaaa gcatcgattc tcttccaaga cgcagctgcg       120
     gtcatttcct tcgacaaaac tagtgagact ttacgggtga tccgcaatgc ctccgtgctt       180
     gtcaccgggg acaccattgc agcaatcatg ccagcgtcag agcatcttca acgcccggct       240
     aataccaccg ttataccgtc cgacggcaag ataatcaccc ctgggtttgt ggacactcat       300
     cgacatgcct ggcagacggc ctttaaaaca ttgggttcga acaccagtct ggcggaatac       360
     tttgcgcgat atagtgaatt ctcaccggcc aagaagatct tcaccccaga ggatgtatat       420
     ataggccagt tgactgggct gtacgaatct cttaacagcg gggtaacttc catcctggac       480
     catgcgcatc atacttggtc tagtgagact gcactggctg gcctccgagc ctcggtggac       540
     agcggagcca ggacctggtg gtgctatgcc tttcataatc tcagcgacgc gacctgggct       600
     tccaattata cccgagagga tcagattgcc gatttccttc gcattgccga gcatggtcca       660
     tggcgaaaga gcgacactgt gtcgctaggg attgcttatg ataacttcgc attggaagat       720
     gctgccgaga ttgagcagat cacctccttg gcattgtacg aggcttcctc gattgagata       780
     cgcagggctg actttatttc aggtcgcaaa acgtttctgc attcacaata cactaccttg       840
     gcggtccttg gagtttacaa ctttctcaac acatctatcc caattgtctt ttcccacgcc       900
     tcttacctga cagtgaagga cgccgagctg cttcgctcaa caaaccaata tatttccatc       960
     actggggaat cagagcgaca ctatggacac gaccacccaa gcagcccgta cattatggac      1020
     caatcctctc tgggaatcga cacccacttc acctacagcg ccgatatcgt cggacaagcg      1080
     cgcatgtggc tgcaggaggt gaggcttcgc ctgtacgctc aggtcctcga ctgttgggac      1140
     attcctccca ataaccccat gtctgtcgaa caagcattct tattggcaac tcgtgcgggc      1200
     gggcttgcac tgcgtcgtcc agacattggt gtacttgtcg aaggcgcaaa ggctgacctc      1260
     gtcgtctttg acggtacctc accgaatatg ctgggttggg ttgacccggt ggcagcggtg      1320
     atactgcact ctaaccccgg ggatgtggag cacgtccttg taaacgggga gtttcggaaa      1380
     cgcgacttca agctcgtcgt ccctggtaac ctcgctgaaa tccagcagag atttcttgcc      1440
     tctgctaggc gcatccaaga ggtgtggaag caaatgcccc ttcctgtatt ggagggctcg      1500
     tttccgaaca caccaggtgt taattactcc aaagctgtga ctgccgatgt ggtgcgtggg      1560
     tggcaaaatg gctatctatc atcttga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page