(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE351

ASFUM1_4.PE351       Location/Qualifiers
FT   CDS_pept        join(complement(1315708..1315956),
FT                   complement(1313942..1315597))
FT                   /codon_start=1
FT                   /gene_family="HOG000222136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206593"
FT                   /orf_name="AFUA_4G04680"
FT                   /product="FGGY-family carbohydrate kinase, putative "
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL84616.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG252634"
FT                   /db_xref="HOGENOM:HBG294587"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000051F409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J7"
FT                   /transl_table=1
FT                   /translation="MPSGDIPPSMASLPYRSSRQPSRQSSRQASMDTRDDIQIHQDHYI
FT                   GIDVGTGSARACIIDAKGNIVGLASENIGLWQPQQGYYRAISQHNIDPTTIRGIGFDAT
FT                   CSLAVFSTVTDEPVSVTGPNFDSDRNVILWLDHRPVKETEKINATKHNLLRYVGGKMSI
FT                   EMEIPKVLWLKNNMPKELFDQCKFYDLADALTHIATGNEKRSFCSVVCKQGYVPVGVDG
FT                   SVKGWQEDFLTAIGLEDLMEDNFKRMGGVDGVVSLFFLSSNPETNDLFSAFLKADSFQN
FT                   GDYLSAGELVGTLCEKAASELGLPPGIAIGSGVIDAYAGWIGTVGAKVELEDEQLSSEV
FT                   AKNDKAQAFSRLAAVAGTSTCHIAMSPNPVFVPGVWGPYRDTIQPGYWMAEGGQSATGE
FT                   LLKYVIETHPAFNQAISIAESYNTNIYEYLNEHLKEMAQEQKAPSVSYLGRHVFFYGDL
FT                   WGNRSPIAEPNMKGSIIGMANDKTVDGLAIYYYATLEFIALQTRQIVETMNKAGHSITS
FT                   IFMSGSQCQNDVLVRLIASACDMPVLIPRYIHAAVCHGAAMLGAKAASADAEGKTEDLW
FT                   EIMDRMSKPGKKVVPTEDKNEKALLNVKYKVFLEQCYKQLEYRKLVDETVSSWKTGDT"
     atgccctctg gtgacattcc acccagcatg gcttcgctgc cgtatcgttc atctaggcag        60
     ccctccaggc agtcttctcg acaggcttca atggacactc gagacgacat tcagatccac       120
     caggatcatt acatcggaat agatgttggc actggtagtg cccgcgcttg tattattgat       180
     gcaaaaggca atattgttgg attagcttcc gagaatattg gtctctggca gccccaacag       240
     ggatactatc gcgctatcag ccagcataac atcgacccga ctactatccg cggaattggg       300
     ttcgacgcga cgtgctcact ggccgttttc tccacggtta cagacgagcc cgtatctgtc       360
     accgggccga actttgattc tgaccgcaac gtgatccttt ggctggacca tcggccagta       420
     aaagaaacgg aaaagatcaa tgctaccaag cacaacttgc tgcgatatgt cggaggaaag       480
     atgtcgattg agatggaaat tcccaaggtt ctgtggctaa agaacaatat gccaaaggag       540
     ctatttgacc agtgcaaatt ctacgacttg gccgatgctc tgacgcatat tgctaccggt       600
     aatgaaaagc gaagcttctg tagcgtggtc tgcaagcaag gatacgtgcc cgttggtgtc       660
     gacgggagtg tgaagggttg gcaggaggat tttctcaccg caatcggtct ggaggatctt       720
     atggaggaca atttcaagcg catgggaggt gttgacgggg tggtgagcct tttctttctc       780
     tcatccaatc ccgagacaaa cgatctattt tcagcgttct tgaaggctga ctcgtttcag       840
     aatggcgact acctcagcgc gggcgaatta gtcggaacat tgtgcgaaaa agcagcgtcc       900
     gagctggggc tgccgcctgg tatcgccatc ggcagtggtg ttatcgatgc atacgctggg       960
     tggataggca ccgttggcgc caaagtcgaa ttagaggacg aacaactgag ctctgaagtt      1020
     gccaagaacg acaaggcaca ggccttctca cgcctggctg ctgtcgctgg cacctcaact      1080
     tgccatattg ccatgtcgcc gaaccctgtt tttgttcctg gcgtctgggg accgtaccgt      1140
     gacacgatcc agcctgggta ttggatggcg gagggtggac agtctgccac aggtgagttg      1200
     ctcaagtatg tgatcgagac tcacccagcc ttcaaccagg cgatctcaat tgccgagtcg      1260
     tacaatacaa atatctacga atatttgaac gaacatttga aagagatggc tcaggaacag      1320
     aaggccccca gcgtctcata cctgggtcgc catgtattct tctatggtga tctctggggc      1380
     aaccggtcgc ccatcgcaga acccaacatg aagggttcta ttatcggcat ggccaatgac      1440
     aaaactgtcg atggccttgc gatctattac tatgcaaccc tggagttcat tgcacttcaa      1500
     acgaggcaga tcgtcgagac gatgaataaa gccggtcata gcatcacatc catcttcatg      1560
     tccggatctc agtgtcaaaa tgatgtatta gtacggctca ttgcatcagc ctgcgacatg      1620
     ccagtcctta tccctcgtta tattcatgct gcagtttgcc acggtgccgc aatgctggga      1680
     gccaaggccg caagtgccga cgccgaaggc aaaacagaag acctgtggga gatcatggat      1740
     cgtatgagta aaccgggaaa gaaggtcgtg ccgacagaag acaagaatga gaaagctttg      1800
     ctcaacgtca agtacaaggt cttcctggaa cagtgctaca agcagctcga atatcgaaag      1860
     ttggttgatg agaccgtgag ctcgtggaag actggtgaca catga                      1905
//

If you have problems or comments...

PBIL Back to PBIL home page