(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE352

ASFUM1_4.PE352       Location/Qualifiers
FT   CDS_pept        join(1317092..1317657,1317744..1317807)
FT                   /codon_start=1
FT                   /gene_family="HOG000170264" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260043"
FT                   /orf_name="AFUA_4G04690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84617.1"
FT                   /db_xref="HOGENOM:HBG054466"
FT                   /db_xref="HOGENOM:HBG327395"
FT                   /db_xref="UniParc:UPI000051EA5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J6"
FT                   /transl_table=1
FT                   /translation="MHFSQVILPFLSLFSSRAFAASPSSAQAQSADILYWPVASSQPSV
FT                   LARISYDPASLASDVVVYSPPRITDLEGGRNLEADAQDLVRVGLFTFTPNNPKHWVGSL
FT                   TSLSLLAENEDQKPTLRLHLGPSGEVYHVSLAASPPSAATSSSKGLNIELLSSEVGPRP
FT                   HLNRPVDVGPDGKSPEEVIEKTFFQKYWWVFLIITFLAMSGSAEGQ"
     atgcacttct ctcaggtcat cctcccgttc ctttccttat tctcctctcg ggctttcgcc        60
     gcgtctccgt cctctgctca agctcagtca gccgacatcc tgtattggcc ggtagcttcg       120
     tctcaaccct cggttctcgc ccgcatctca tacgatcctg catctttagc gtcagatgtg       180
     gtagtctatt ctccaccaag gatcacagat cttgaaggcg gccgtaatct cgaagcggat       240
     gcccaagatc tcgtccgcgt gggtctcttc acattcacgc caaacaaccc aaaacattgg       300
     gtaggctctc ttacgtcact ctctttgctt gcagagaatg aggatcaaaa gccaactctg       360
     cgacttcatc ttgggccctc gggcgaggtc taccacgttt cattggcggc gtctccacca       420
     tctgcggcaa catccagctc caagggcttg aacatagaac tcctatccag cgaagtcggt       480
     ccgcgtccac atctcaatcg ccctgttgat gttggcccag atgggaagag tccagaagag       540
     gtcattgaga agaccttttt ccagaaatat tggtgggtct tcctcattat cacatttttg       600
     gccatgtcag gcagcgctga aggacaataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page