(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE354

ASFUM1_4.PE354       Location/Qualifiers
FT   CDS_pept        join(complement(1321674..1322696),
FT                   complement(1321070..1321582),complement(1320830..1321030))
FT                   /codon_start=1
FT                   /gene_family="HOG000170253" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260044"
FT                   /orf_name="AFUA_4G04710"
FT                   /product="Protein tyrosine phosphatase (Pyp1), putative "
FT                   /EC_number="3.1.3.48"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="EAL84619.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG054468"
FT                   /db_xref="HOGENOM:HBG327383"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI000051EA4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J4"
FT                   /transl_table=1
FT                   /translation="MATYDNTLSGNLAPTTINTMSCEQCAELLETCGNDVLLLDVRPYA
FT                   HYARGHIKGSLNLCIPTTLLKRTSFDTRKLANTFTSDIDRRSFSRWKQCRYIIVYDAAT
FT                   LDMKDAVPMINMLNKFTAEGWNGEGSILRGGFKVFCNQFNALVQQPESSNPGISSNKPN
FT                   SMQISLPPFAPIAGGCALPESSSAAIPFFGNIRQHMDLMGGVGQIPLQLPQNLTDSKRR
FT                   LLPRWLRDASDVEDGGQKVSEKFLELEKKELDRMKQALSYEMTGVSTSAQAPSKKYRVA
FT                   GIEKGNKNRYNNIYPFDHSRVRLQDVPSGGCDYVNANYMKAEYSNKRYIATQAPVPETF
FT                   DDFWRVIWEQDVRIVVSLTAEIERGQVKCHRYWESGNYGPFRVNNFSERRIPMKASGSR
FT                   QNQGQSTTSLSDSSEEPSEPCIIVRHFGLSHSAFPFQPLREVTQLQYPYWPDFGTTSQP
FT                   SHLLQLVDECNAIIRATSNTCFDTRKAMPTEHRPVLVHCSAGCGRTGTFCTVDSTEPRE
FT                   ISERPDTGWIYNDNVDLIAKAVADFRTQRPSMIQNLSQFVLCYESVLEWMVVQMDEGCE
FT                   NP"
     atggccactt atgacaacac tttgtctggg aacctggccc cgactactat caataccatg        60
     tcatgtgagc aatgtgcaga gttattagag acctgtggaa acgatgtttt gctactagat       120
     gtgcggccgt atgcacatta tgccagggga cacatcaagg gttcgctaaa cctctgtatc       180
     cctacaacgc tcctcaaacg gacttcgttt gacacgcgga agttggccaa caccttcacg       240
     agcgacattg accgaagatc attctcaaga tggaaacaat gccgctacat catcgtttat       300
     gacgctgcta cacttgacat gaaagatgcg gtgccaatga tcaatatgtt gaacaagttt       360
     acggctgagg gatggaacgg cgaaggttcg attcttcggg gtgggttcaa ggtcttctgc       420
     aatcagttta atgcgcttgt tcagcagcct gaatcatcga accctggaat atcttcaaat       480
     aagcctaatt cgatgcagat tagccttccg ccatttgcac ctatcgctgg tggctgtgct       540
     ttgccggagt cttcttctgc cgccatcccc ttctttggga atattcgcca gcatatggat       600
     cttatgggcg gtgttggtca gattccgctc cagctcccac agaatttaac agactccaaa       660
     agacgattgc ttccacgatg gctccgtgac gcttccgatg ttgaagatgg aggtcagaag       720
     gtgtcagaga agttcctgga gctcgagaag aaggaattag accgtatgaa acaagctcta       780
     tcatatgaaa tgaccggagt ttctacgtct gcgcaagccc cgtcgaagaa gtatcgagtt       840
     gcagggatcg agaagggcaa caagaacaga tataataata tctatccctt tgatcattcc       900
     agggttcgct tgcaggatgt tccttcagga ggttgtgatt atgtgaacgc gaattacatg       960
     aaggctgaat acagcaataa gcgctacata gcaacgcaag ctccagtgcc cgaaacattt      1020
     gatgactttt ggcgtgtaat ctgggagcaa gatgttcgaa ttgtcgtttc tctcacagca      1080
     gaaattgaaa ggggccaagt taaatgtcac cggtattggg agtcagggaa ttatgggcct      1140
     tttcgagtca ataacttttc tgagcgacgc attccaatga aagcgtccgg gtcccgccag      1200
     aaccagggtc agtcaaccac gtcattgtcg gattctagcg aagaacccag cgaaccatgc      1260
     attatcgtca gacattttgg cttgtcacac tcggcttttc catttcaacc actacgagaa      1320
     gtcacccagc tgcaatatcc ctattggccg gattttggta ctacgtcgca accatcacac      1380
     ctccttcagc tggttgatga atgcaacgca atcatacggg caacaagcaa tacgtgcttt      1440
     gatactcgca aggcaatgcc aactgaacat cgacctgtat tggtgcattg cagtgcggga      1500
     tgcggccgta ctggtacctt ctgtacagtg gatagtaccg aacctcgaga aatcagtgaa      1560
     cggcctgata ctgggtggat ttataacgat aacgtggacc ttattgcaaa ggcagtcgcc      1620
     gactttcgaa cccagcgacc tagcatgata caaaatttga gccagtttgt cttatgctat      1680
     gaaagtgtat tggagtggat ggtggttcaa atggacgaag gatgtgaaaa tccttga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page