(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE359

ASFUM1_4.PE359       Location/Qualifiers
FT   CDS_pept        join(1336681..1336828,1336879..1337081,1337154..1337237)
FT                   /codon_start=1
FT                   /gene_family="HOG000170196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902010"
FT                   /orf_name="AFUA_4G04750"
FT                   /product="NADH-ubiquinone oxidoreductase 21 kDa subunit,
FT                   putative"
FT                   /protein_id="EAL84623.1"
FT                   /db_xref="HOGENOM:HBG177444"
FT                   /db_xref="HOGENOM:HBG398231"
FT                   /db_xref="InterPro:IPR019721"
FT                   /db_xref="UniParc:UPI00005206A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9J0"
FT                   /transl_table=1
FT                   /translation="MAAASPLAFWAMERVSPSHVGRGGFAPVMRLATAIGLIGGLHILY
FT                   QRSCNRFYGFTENAREVEMDMREMVDKVKKGEPLYGTSQVSSYLQGVAARNSRYSQLFI
FT                   HVLPWFNIVNHDQHGVDTAKYYQQAERELEAERLTTAGSH"
     atggccgctg cctcccctct cgcattctgg gctatggaga gggtcagccc ttcccatgtg        60
     ggccgaggag gctttgctcc tgtgatgcga ctggcgacag caatcggttt gattggaggt       120
     ctgcacatac tttaccagag atcttgcaac cgattctacg gattcacgga aaatgccaga       180
     gaggtcgaaa tggacatgag ggaaatggtc gacaaagtca aaaagggcga gccgctatac       240
     ggtacatcac aagtatcctc ttacctacaa ggcgttgctg ccagaaattc gcggtactct       300
     cagcttttta tccatgtcct tccttggttt aacattgtca atcacgacca gcatggtgtt       360
     gacacagcaa aatattatca gcaagctgag cgtgaactcg aagccgagcg cttgacgaca       420
     gccggttctc actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page