(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE360

ASFUM1_4.PE360       Location/Qualifiers
FT   CDS_pept        join(1338940..1339534,1339588..1340246,1340305..1340558,
FT                   1340615..1341013,1341126..1341278,1341335..1341431,
FT                   1341543..1341944,1341988..1342026,1342080..1342322,
FT                   1342381..1343605,1343672..1344217,1344273..1344744,
FT                   1344800..1345085,1345142..1345239,1345290..1345382,
FT                   1345434..1345595,1345661..1345761,1345834..1346006,
FT                   1346057..1346342,1346396..1346593,1346641..1346765,
FT                   1346826..1346908,1346961..1347083,1347147..1347234,
FT                   1347284..1347541,1347589..1347780)
FT                   /codon_start=1
FT                   /gene_family="HOG000170185" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260049"
FT                   /orf_name="AFUA_4G04760"
FT                   /product="Inositol kinase kinase (UvsB), putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /protein_id="EAL84624.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG054471"
FT                   /db_xref="HOGENOM:HBG324449"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012993"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI0000F51AC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I9"
FT                   /transl_table=1
FT                   /translation="MATNESWVPYQFTTTNSVSRSAEPASSILAAQLAPHLVSQGNSAH
FT                   GYLTRETFSQLRQELVDGKCSQLGLDDSIADASKLICIVLQAGIEPCVKGDRSRQGDFE
FT                   GQILDCLDIIQTILEKSPQVLGEICDPTILGENTSISLYAWLTLRLLNLLSWEANNIGK
FT                   RITSIFSSIIRPHYKHTTLLPFCYSALALLRACTNEIFLSLESHHNLLRQHMSEVRLSI
FT                   PAVKSAIFLTLDNLNLPRALLSKKITLGTFPQTITLALRLLDSFVPKRAFHSHTSIKDP
FT                   TLHQDLAWILNGIERLWRITHRWARTSMDDIEIKSRICMQFTSSLHIYRSLEPDISGLL
FT                   SPQSGLARPWVQICNDLVTLSLIQMPHLQAELGRLLDELIDASQPRLEVVTQFRAALLP
FT                   TMIDFKSKGTIQSFEPGFQAVLQILMGPMSGAESRSLVNLQEPNTAGQTGQQDEMLQHG
FT                   TTHDIPRPQEGSARLDTAHKLISKIFELLGCGEPVNVECLSHAISESFVDLPDQKKSDL
FT                   LYMLGRVACAMAGSLSSPSKAAPEISLSCSVCETEKRALGPEPASKPRDVHELCEIFTF
FT                   ILPRLTRASSLRVTAMDALRRLLVHAPPESCYLQLKSSVFGDFCLHSLRSSIRELRIVT
FT                   GRLVISFVRKDINADTRRSNFVVILEWLRSLSEKQELPLHETCILTLCHIAEVSDDEEM
FT                   NIILLRLLEYLGHPNPFICAVAYAELSKLAQRLSVTPAGLFRPFWRTLSITVVKNFQSR
FT                   PHMAEQLCDLLGMNVDDFLRLTEVHILPYLVLTRKRDVITRVGAAYKHIKTPFDICSEK
FT                   NNLAAILAFLMSQPWSDPEGMIMSVLSDIDSAFGGRTLAELALVIREVRKAHGHFHRAL
FT                   HLLAALVPRKSTATSKKANLLCHFIEEHVLGIITQFAHAINDFQIRQPLIEKRRNILAI
FT                   GEMIKVARGHISSALPQICACLRSALSIEELSDHAFSAWSVLVSSLHEEELEPLIDQTF
FT                   SIVIRYWDAFNYQSKKTAEELIGYILRSHSGLVHTNFSTIPSLASIPALSALESEISKM
FT                   KEKMDVRSQLSAFGRRCQSENAAVVEQALRELLPCLSRHEEFLHESVLSEQPDPVVAQL
FT                   TRSLLDCCVKFNAGSDSITLLSAQCLGLVGCLDPNRVDPVKDKKDILVLSNFDRMEETF
FT                   DFVLFFLQHVLVQAFLSASNTRAQGFLAYAMQNLLRLCNLDSAVTQRSRDVQADEKYRR
FT                   WSELPETVRNTLTPFLTSKYTVTVGAIRSRCKFPIFSTELTHGDWLRSFVQDLLQRGSG
FT                   DNAQLIFSVCSRIVKGQDISIASFLLPFAVLNRIVGGTQEERLDLQSELTTILSHPLPE
FT                   ASNRVHEAIILCRQSVFEILDYLSRWLQGKKKLLHGLKNHASHTGRSHKDSHQDSLSET
FT                   YSSQVKAVETFLGSIPPEVISKRAVECKSFSRALFHWEQYIRRFKSQSDKNDHTSTELL
FT                   YQHLQVIYSQIDEPDGIEGISSHLHVLNIDQQVLQHRKAGRWVTAQSWYELQVEKEPDN
FT                   IDAQWNLLTCLRESGQQDAIIARVDTLNSAGSTSRFLPFAVEASWITGNWDKLRSYLQM
FT                   RSPENTGDFNIGVGSALCALRLGNKTEFRNIIHDLQLSVAKSLTVNSVTSLQSCHDSIL
FT                   KLHALTEMELISDCEGTENSSLTSIHDVLNRRLDVLGGYIADKQYLLGLRRATMELTHG
FT                   FMESDIAGSWLTSARLSRKGNYTNQAYHSMLRAARLKDRSATIEHARLLWKDGHHRKAI
FT                   QTLEGAIAANEFASDTSSSGGLKNEKQQNLIAARAHLLLAKWTDRAGQTQSDVIVQRYR
FT                   EAIKLHSRWEKAHYYLGKHYDKILESEKAKPLGKEAQIYLSGEASKLVIDNYLRSLAHG
FT                   NKYVFQSLPRILTLWLEHAATVDKPFDPKRGDNEEFQTHTLNQRKKTLDDMHSQLKKYL
FT                   NRMPAALVMVARICHPHATVYELLTRIVAKVANAFPQQGLWTVLAVVKSSSKDRASRGI
FT                   NCLHKITEANKKSRTEFPLDMRGMINQGQKFTEEMLKLCTARVEEKASRIHLARHLGFS
FT                   HKVAPCRLVVPFQAMLTPSLPASHETEYLKGFRAFPRDPTTIDAVLDDAQVLSSLQKPR
FT                   KISIRGSDGKIYNVLCKPKDDLRKDQRLMEFNNTINRFLKKDVESSKRRMYIKTYAVTP
FT                   LNEECGLIEWVDNLRTLREIIIKLLKERGIMPNYNEIRHYLNEACSEASKLHLFTTKVL
FT                   MKFPPVLHEWFVEMFPETGAWFAARLRYTRSCAVMSMVGYVLGLGDRHGENILFEEGTG
FT                   GVIHVDFNCLFDKGLTFEKPELVPFRLTQNMIDAFGAYGYNGLFPKSLKDEAFAQLLFT
FT                   GPFRRTCEISLRLLRQNEDALMTVLETFLHDPTTDFIGKKRRTHANVPETPAGVLENVR
FT                   NKLRGLLPGESVPLSVDGHVDELITQATDKRNLAAMYIGWCAFF"
     atggccacca atgagtcgtg ggttccctat caattcacca ctacaaacag cgtgtcaagg        60
     tccgcggaac cagcttcgtc gattctggca gctcaacttg cgccgcacct ggtgtctcaa       120
     ggaaatagtg cccatggtta cttaactagg gaaaccttct cgcagctgcg ccaagagctg       180
     gttgatggga aatgtagcca actgggtcta gatgacagca tcgcggatgc tagcaaactg       240
     atttgcatcg tgctgcaagc aggcatcgag ccttgtgtca agggcgatag gtcccgccag       300
     ggagattttg aaggccagat actagactgc ctggacatca ttcaaacaat tcttgaaaag       360
     tcaccgcaag ttttgggtga aatatgtgac ccaaccatct tgggagagaa tacgagcata       420
     tctctgtatg cgtggctaac attgcgattg ctaaacttgc tcagctggga ggcgaataac       480
     ataggaaaga ggataacctc catattctcc agcatcatcc gtcctcatta taagcataca       540
     acgttattgc ccttctgcta ttctgcttta gcactcctcc gagcgtgcac gaatgaaatc       600
     ttcctttcgc tcgagagtca tcataactta ttgagacagc atatgtcaga ggttagacta       660
     tcgataccag cagtgaagag tgcaatcttc ctgaccctgg acaatctcaa tcttcctcga       720
     gctcttttga gcaagaagat tacgctcgga acatttcccc agacaattac acttgctctt       780
     cgactactgg actcctttgt tccaaaaaga gcattccata gtcacacgag catcaaagat       840
     cctacccttc accaagacct ggcttggatc ctcaatggaa ttgaacgtct atggagaatt       900
     acccatagat gggcgcgcac ctcaatggat gatattgaaa tcaagtcacg catttgtatg       960
     caatttacgt ccagtctaca tatctatcgc tcccttgaac ctgatatttc tggtctctta      1020
     tcgccacaat cgggtctggc acgtccctgg gttcagatct gtaacgattt agtcacattg      1080
     agcctgattc agatgcctca tcttcaggcg gaattaggcc ggcttcttga cgagttgatc      1140
     gacgcgtctc aacctcgttt agaagtagta actcaattca gagccgctct tttaccaaca      1200
     atgatcgact tcaagagtaa gggcaccatt cagtcgtttg agccgggttt tcaggctgtg      1260
     ttgcaaatat tgatgggacc catgtctgga gctgaaagta ggagtctcgt caatttacaa      1320
     gaaccaaata ctgctggcca aacgggccaa caagatgaaa tgcttcaaca tggtacaacc      1380
     catgacattc cacggccgca agaaggctcc gcccgccttg acacagcaca taaacttatt      1440
     agcaagattt ttgagctact gggctgcggg gaacccgtaa atgttgaatg cctcagtcat      1500
     gctatttcgg agtcgttcgt ggatctcccc gatcaaaaaa agtccgacct tttgtatatg      1560
     cttggcaggg tcgcatgtgc gatggctggg agcctttcaa gcccaagtaa ggctgctccg      1620
     gaaatctcac tatcttgcag tgtgtgtgaa actgagaaaa gagcgcttgg tcctgagccc      1680
     gcttcgaagc cgcgtgacgt tcatgagcta tgcgagatct tcaccttcat tctacctaga      1740
     cttacacgag cttccagtct cagagtaaca gcaatggacg cgttgcgaag gctattggtc      1800
     cacgctcctc ctgagtcttg ctacctgcag ctgaaatcct ctgtcttcgg cgacttctgt      1860
     ctgcactcac ttcgaagttc gattagagag ctgagaatag tcactgggcg tctggtgatc      1920
     tcttttgttc gaaaagatat caacgctgat actcgtcgaa gtaactttgt cgtcatacta      1980
     gaatggctgc ggagcctctc tgagaagcaa gaactcccgt tacatgagac ttgcattttg      2040
     accttgtgcc atattgcaga ggtttccgac gacgaagaga tgaacatcat tcttcttcgt      2100
     ctactggagt acttgggcca tccaaatcca ttcatttgcg cagtagcgta cgctgagctt      2160
     tctaaacttg ctcagcgtct ctctgtgact cctgctggtt tgttccggcc tttctggagg      2220
     acattgtcga taacggtggt gaagaatttt cagtcccgtc cacacatggc tgagcaactc      2280
     tgtgatctgc tgggaatgaa tgtagatgat tttttaagat taactgaggt tcacatcctg      2340
     ccatatcttg ttctcactcg aaaacgagac gtcatcacga gggttggtgc agcctacaag      2400
     catatcaaaa cacctttcga catttgctcc gagaagaaca accttgcagc gattcttgct      2460
     tttttgatga gtcaaccgtg gtcggacccg gaaggtatga tcatgtccgt tctatccgat      2520
     attgactccg ctttcggcgg acgcactttg gcggagctgg ccttggtgat tcgggaagtg      2580
     agaaaggcgc acgggcattt tcatcgagct ctccatttgt tggcagcctt agttccccgc      2640
     aaatctactg ctacatcaaa gaaagctaat ttgctttgcc atttcattga ggagcatgtt      2700
     ctgggtataa tcacgcagtt cgcgcacgca atcaacgact ttcaaataag acagcctttg      2760
     attgaaaaga ggcgaaatat cttggccatt ggtgagatga tcaaagttgc ccgtggccat      2820
     atcagcagcg cattaccaca gatatgtgcg tgcctgcgtt ccgcacttag catcgaagag      2880
     ctcagtgatc atgccttttc ggcctggagc gtgttggtca gctctctgca cgaagaagag      2940
     ctcgagccac tcattgatca aacattctca attgttatca gatactggga tgcttttaac      3000
     tatcaaagca agaagactgc cgaggaactg atcggttata ttctcagaag ccacagtgga      3060
     ctagtacaca ctaatttcag caccatcccc tcattggctt caattccagc attatctgcg      3120
     cttgaaagtg agatcagtaa gatgaaagag aagatggatg ttcgaagtca actttcggct      3180
     tttggacgtc gctgccaaag tgagaatgcc gctgttgttg aacaggcatt gagagagctg      3240
     ttgccctgtc tttcaaggca tgaagaattc ttgcatgagt ccgtactaag tgaacagcct      3300
     gacccagttg ttgcacaatt aacaaggtcc ttgctggatt gctgcgtcaa gttcaacgcg      3360
     ggttccgaca gcataacact tctttcggct caatgtctgg gccttgtagg ctgtctggat      3420
     ccaaatcgag ttgatccggt caaggataaa aaggatattc tcgttttatc aaacttcgac      3480
     agaatggaag agacctttga ttttgtactt tttttccttc aacatgtgct ggttcaagcc      3540
     ttcttgtcgg cctccaatac gagggcccaa ggttttcttg cctacgctat gcagaacctg      3600
     ctcagactct gcaacctcga ttcggccgtc acccagcgct cccgagatgt tcaagcggat      3660
     gaaaagtacc gtcgttggtc ggaattacct gagactgtgc gcaatacttt gacccctttt      3720
     ctcacgtcta agtacacggt cacagtcggt gccataagat cgcgttgcaa gttcccgata      3780
     ttttccacag agctgacgca tggcgattgg ttgcgaagtt ttgtgcagga tctgctgcaa      3840
     agaggaagcg gtgacaacgc acagcttatt tttagcgttt gcagtcgtat tgtcaagggt      3900
     caagatattt caatcgccag ctttctccta ccattcgccg tactaaatcg tatagttggt      3960
     ggaacccagg aggagaggct agacctgcaa agtgagctca caaccatact ctcccatccg      4020
     cttcctgaag caagtaatcg ggttcacgaa gccatcatac tatgcagaca gagcgtcttt      4080
     gaaattttgg actacctttc aaggtggcta caggggaaaa agaagctcct ccacggcctc      4140
     aagaatcatg catctcatac tggccgttct cataaggatt ctcatcaaga ttcattatcc      4200
     gaaacgtatt cgtctcaggt caaagctgtg gaaaccttct tgggctcaat acccccagaa      4260
     gtcatttcga aaagagctgt cgaatgcaaa tcattttcca gggccttatt ccattgggaa      4320
     cagtatatcc gccggttcaa gagtcaatcc gataagaatg accacacaag cactgagctt      4380
     ctctaccaac atctccaagt gatttacagt caaattgacg agcccgatgg tattgagggc      4440
     atttcatctc atttgcatgt gctgaatatt gaccaacagg tcctccaaca ccgcaaggcg      4500
     ggcagatggg ttactgcgca aagttggtac gaactgcaag tcgaaaaaga acccgacaac      4560
     attgatgcgc agtggaatct tcttacgtgt cttcgagagt cagggcaaca agatgccatt      4620
     attgctagag ttgatacgct caactcagct ggctcaacgt cgagatttct tccctttgct      4680
     gtggaagcgt cttggatcac aggaaattgg gataagcttc gcagttacct ccaaatgcgc      4740
     tcaccggaaa atacaggaga cttcaatatc ggggtcggat cggctctttg tgcgcttcga      4800
     cttggaaaca agactgaatt ccgtaacatc attcatgatc tgcagctcag tgtcgccaaa      4860
     tcgctgactg taaactcggt tacttcccta caatcttgcc atgacagcat cctcaagctg      4920
     catgccttga ctgaaatgga acttatttcc gattgtgagg gcaccgaaaa tagctcgctc      4980
     actagcatac atgatgtact aaatcggcga cttgacgtcc ttgggggata catagctgac      5040
     aagcagtacc tgcttggatt gagaagggcc acaatggaat tgacgcatgg tttcatggag      5100
     tcagatatcg ccggttcctg gcttactagt gcacgtctgt cgcgaaaggg taattacacc      5160
     aatcaggcct atcactcaat gcttcgtgca gctcgcttga aagataggtc agctactatt      5220
     gagcacgccc gtctactttg gaaagatggt catcatcgaa aagccataca aacgttagag      5280
     ggtgcaatag ctgcaaatga attcgcctca gacacatcct catccggtgg gttgaaaaat      5340
     gaaaagcaac agaacttgat tgctgctagg gcccatctct tgctagcgaa atggacagac      5400
     cgagcgggac agacccaatc cgatgtgatc gtacagaggt accgagaagc gatcaaactt      5460
     cactcaaggt gggaaaaggc gcattactac ctgggcaaac actacgacaa gatcttggag      5520
     tctgagaagg ccaaaccctt agggaaagag gcccagatat acttaagcgg tgaagcctca      5580
     aaacttgtca ttgataacta ccttcgttcg ttggcgcacg ggaacaaata cgttttccag      5640
     tcactgccca gaattttgac tctttggtta gagcatgctg ccacagttga taaacctttc      5700
     gaccctaaaa ggggcgataa tgaagagttc cagacgcaca cattgaatca acggaaaaaa      5760
     actcttgatg atatgcattc acagcttaaa aaatatctaa accgaatgcc cgcggcgctg      5820
     gtcatggtcg ctcggatatg ccatccccat gccacggttt acgagctttt aaccaggatt      5880
     gtggcgaaag tagccaatgc ttttcctcag caaggactct ggacagtcct tgcagttgtc      5940
     aagtcctcct cgaaggatcg agcttctaga ggcatcaatt gtcttcataa aatcactgag      6000
     gcaaacaaaa agtccagaac agaatttcct ttagacatgc gaggaatgat caatcaagga      6060
     cagaaattca cagaggagat gctcaaacta tgcacagcac gagttgagga gaaggcgtca      6120
     aggattcatc ttgcccgaca tcttgggttc agccacaaag ttgccccttg tcgacttgtt      6180
     gttcctttcc aggctatgtt gactccaagt cttccggcca gccatgagac cgaatatttg      6240
     aagggattca gggctttccc cagagacccc acgaccatcg acgccgtact tgacgatgca      6300
     caagttctga gctcactgca gaagccccga aaaatcagca ttcgaggctc cgatgggaaa      6360
     atatacaacg tcctctgcaa acctaaggat gatctccgca aggaccagcg tcttatggaa      6420
     ttcaataaca cgatcaatcg ctttctaaaa aaagatgtgg agtccagcaa acggcgcatg      6480
     tatatcaaaa cttacgccgt tacccctctt aatgaggaat gtggtctaat tgagtgggtt      6540
     gacaatctga gaacattgag agagatcatt atcaagctcc tcaaagagag aggtatcatg      6600
     ccgaattaca acgaaatcag acactatctt aacgaagcat gctcagaggc ctcaaaactt      6660
     cacttgttca caacaaaagt tttgatgaaa ttccctccag ttttgcacga atggtttgta      6720
     gaaatgtttc cagagacggg ggcatggttt gcagcacggc tccgttatac caggtcctgt      6780
     gcagttatgt caatggtcgg atacgtcctg ggactgggag accggcatgg cgaaaatatc      6840
     ctgtttgagg aaggcacagg tggtgttata catgttgatt tcaattgcct ttttgataag      6900
     ggcttaacat tcgaaaaacc tgagttggtc ccattccgtc tcacccaaaa catgatcgat      6960
     gctttcgggg cctatgggta taatggtttg tttcccaagt ctctcaaaga tgaagcattt      7020
     gctcaactct tgttcacagg accgttcaga aggacatgtg aaatcagcct tcgccttctg      7080
     cgacagaacg aggatgcact tatgaccgtg ctggagactt tcttgcatga tccaaccaca      7140
     gatttcattg gaaagaagcg tcgcacccat gcaaatgttc cagagacccc cgctggggtg      7200
     ctcgagaatg ttcgcaataa actccgaggc cttttgcccg gagagtcagt tcctttatca      7260
     gtggatggcc atgttgatga actaatcaca caagcaacgg acaagagaaa tctagcggcc      7320
     atgtatatcg gctggtgtgc ttttttctga                                       7350
//

If you have problems or comments...

PBIL Back to PBIL home page