(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE373

ASFUM1_4.PE373       Location/Qualifiers
FT   CDS_pept        join(complement(1505044..1505103),
FT                   complement(1504489..1504970),complement(1504414..1504438))
FT                   /codon_start=1
FT                   /gene_family="HOG000187575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260055"
FT                   /orf_name="AFUA_4G05910"
FT                   /product="NADH-ubiquinone oxidoreductase 21 kDa subunit,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EBA27398.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324386"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniParc:UPI0000F51C1B"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N7"
FT                   /transl_table=1
FT                   /translation="MTRDVLKAAKSASNAIAVHKSTGIWERLRRLLAIDPNRSTGVPLN
FT                   SQYRLPTPGALPPQSYDDPVTVPAADIADNPYWKRDVRRNYPRLSIVNQADAVGLLTVG
FT                   SRAAPKDDVLQTGQAGEQQLVEVKQQGEERGLAAIFEKDKRGIQGVLGADGLPPTPCNL
FT                   NASAAKYQLGQGQGYPAVYPCRTFV"
     atgactcgcg acgtcctcaa agccgccaag tccgcatcga acgcgatagc cgtccataag        60
     tctacgggga tatgggaacg tcttcgccgt cttcttgcca tcgatcccaa tcgctctact       120
     ggagtcccac ttaactcgca atatcgactt ccgactcctg gtgctctccc gccgcaatct       180
     tatgatgacc ccgttactgt cccagcagca gacattgccg acaaccctta ctggaagcgc       240
     gacgtccgga gaaattaccc cagacttagc atagtcaacc aggcagacgc tgttggcctt       300
     cttacagtag gtagccgggc ggcgcccaag gacgacgttc tgcagaccgg gcaggcagga       360
     gagcagcagt tggttgaggt taaacagcaa ggagaagagc gtggcctcgc tgccatattt       420
     gagaaggaca agaggggcat ccagggcgtt ctgggcgccg atggtctgcc gccaactcct       480
     tgtaacttga acgcctctgc ggccaagtat cagcttggtc aaggtcaagg ctatcctgct       540
     gtgtatcctt gccggacgtt cgtctaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page