(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE375

ASFUM1_4.PE375       Location/Qualifiers
FT   CDS_pept        join(1507492..1507644,1507718..1508137)
FT                   /codon_start=1
FT                   /gene_family="HOG000187596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902014"
FT                   /orf_name="AFUA_4G05920"
FT                   /product="Mitochondrial protein sorting (Msf1), putative "
FT                   /protein_id="EAL90194.1"
FT                   /db_xref="HOGENOM:HBG054283"
FT                   /db_xref="HOGENOM:HBG602019"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI000051F03E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ0"
FT                   /transl_table=1
FT                   /translation="MKVFSSTCTFDYSWEEVSTANWRKYCPWNDKSTHVVAVDTISRTV
FT                   DPKTGILRTERLITCDQSVPQWVLSLFGGSATSHVYEISYVDPGAKKVTMCSTNLTWSN
FT                   VLNVRETVIYQPSSSKPELVTDFSQEAKITALCGGWQKIKNKVEEASIERFSQNAKRGR
FT                   EGFETVLEMSRRVFGEQREFENKKLQS"
     atgaaggtct tctcctcgac atgcaccttc gattattctt gggaagaagt ttcgactgcg        60
     aactggcgca aatattgccc ttggaatgac aagtcgaccc atgttgtggc ggtagacacc       120
     atatctagga cggtagatcc gaaaactggc attttgcgta cggaacgcct catcacttgt       180
     gatcaatcag taccgcaatg ggttctctca ttgttcgggg gaagcgctac ttctcatgta       240
     tacgaaatct catatgttga tcctggcgca aagaaggtca ctatgtgctc aacaaatctt       300
     acgtggtcta acgtcttgaa cgtgagagaa actgttattt accagccttc gtcatcgaaa       360
     ccagagttgg tcacggattt cagtcaagag gccaaaatca ctgccctttg cggcggctgg       420
     cagaaaatca agaataaggt agaggaggct agcatcgaga ggttcagcca aaatgccaag       480
     agaggcagag agggtttcga aactgttctt gaaatgagcc gaagggtttt cggtgagcag       540
     cgtgagttcg agaacaagaa attacagtcc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page