(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE378

ASFUM1_4.PE378       Location/Qualifiers
FT   CDS_pept        join(complement(1513062..1513091),
FT                   complement(1512708..1512987),complement(1512460..1512611))
FT                   /codon_start=1
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260059"
FT                   /orf_name="AFUA_4G05950"
FT                   /product="Glutaredoxin Grx5, putative "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="EAL90191.2"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG054279"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000F51BCE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ3"
FT                   /transl_table=1
FT                   /translation="MMFQRQAFAPAFRPFSRSPLVLTPRFTAFQLPHALHARFLSEQTR
FT                   SAIDKAIASAPVVLFMKGTPETPQCGFSRASIQILGLQGVDPKKFVAFNVLEDPELRQG
FT                   IKEYSDWPTIPQLYLDKEFIGGCDILMSMHQNGELAKLLEEKGVLVAAD"
     atgatgtttc aaaggcaagc ttttgcgcca gcatttcgac ctttttcccg gtcaccactt        60
     gtcttgactc cacgattcac ggctttccaa ctgccgcatg ccctccatgc ccgatttctc       120
     tcggaacaga caaggtcggc aattgacaag gctattgcgt ctgcacctgt cgtcctcttc       180
     atgaagggta ctccggagac accacaatgt ggattttctc gagccagcat acagattctg       240
     gggttgcagg gagttgaccc gaagaaattt gtcgcattca acgtgttgga ggatcccgag       300
     ctgcgtcagg gtataaagga gtactccgat tggccaacaa taccccagtt ataccttgac       360
     aaggaattta ttggaggttg cgatattctg atgtctatgc atcagaacgg agagctcgca       420
     aagctgcttg aggagaaagg ggtcctagtg gcagctgatt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page