(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE38

ASFUM1_4.PE38        Location/Qualifiers
FT   CDS_pept        join(complement(127632..127848),complement(126741..127500),
FT                   complement(126278..126694),complement(125315..126230))
FT                   /codon_start=1
FT                   /gene_family="HOG000200311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753330"
FT                   /orf_name="AFUA_4G00490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84369.1"
FT                   /db_xref="HOGENOM:HBG054127"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000051FC28"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W972"
FT                   /transl_table=1
FT                   /translation="MRFSWQRSAGISALLVGCSLAQGWNVNVSMCNWDQVRGILRPSCP
FT                   SAAKAYMSQLVRFATLFTLTEGHCGGSGNSDGLLYYLNLNTSFDTAISNLTALFGNISK
FT                   AGGIANNIAPTYRDGAMFTNDNELYLYGYFDSLFTNSRLTICSGLLRLTDSQDPPAGNT
FT                   VLGYERYQYGPDRESWQPGFIIDNLDTGVTRYVTNGAGVSAPNENLGFYFSGMRGKDWG
FT                   PIYADDKSANVTSDRMIKVDMSSMRHNKWSNLSLPAHVPARANGELVWVPVAESGVLVA
FT                   IGGVINPATIFSSDGLTSAQQNASKRVSPGLMETVSVYDVSGDKWYLQNTTGDIPPQLT
FT                   QFCSIHASAQDGSSHNIYIYGGYDGLSMENTPSDDVYVLSLPSFSWIKLYSGNTTHGRS
FT                   GHRCVKPYPDQMLVLGGVHLDPTHCLDGGVIQVFNLNTGRFQNTYNPNVWNEYKVPDLI
FT                   TTVIGGDSEGGATKASPISWTNASLADVFKTKYTNTISTWYPYNSTSSISPTIAPAADK
FT                   GSSFPKWASAIIGVILGFLFISAAAIFWFLRRRHKLRESQSTGDRSTRSWILRWLHTSG
FT                   SATGVPKSGDTTAPTGYSVFTNESTITPATAVSPQSVEAGSDPVYEMLGQFFNLLFLYP
FT                   ANHCEGHATTLPVELPTPYNNNSLPSPVSPPGVSGTDYVSPITVSTPSTEDEASPVRPP
FT                   HYRHMSSLSSVPTIANVMRKESRHRQTYRSDTSEGSVELECPRGVELSGSTPQEGRLAT
FT                   TREVDELEGLGIKALP"
     atgcggttca gttggcaaag gtccgctggc atatctgccc ttttggtcgg ctgttcgtta        60
     gcgcaaggat ggaatgtcaa tgtgtctatg tgtaactggg atcaagttcg aggtatactc       120
     cgtccaagct gcccaagtgc tgccaaggct tatatgtctc agttagtacg attcgcgaca       180
     ctgtttacct tgacggaggg tcactgtggt ggaagcggaa acagtgatgg gcttctttac       240
     tacctcaatc tcaacacatc atttgataca gcaatctcaa acctgactgc gttgttcggc       300
     aacatatcga aagctggagg aatcgcaaac aatattgccc caacctaccg cgatggagcg       360
     atgtttacga acgacaacga gctatatctt tacgggtact tcgactctct cttcaccaat       420
     tcccggctga ccatatgtag tggcctcctc cgtctcacag acagtcaaga ccccccagct       480
     ggcaacaccg ttctcggcta cgaacgatac cagtatggtc cggatcgaga atcctggcaa       540
     cccggcttta tcatcgacaa cctcgacact ggcgtgaccc gatacgtgac gaatggcgcc       600
     ggagtctctg caccgaacga aaacctcggg ttctacttca gcggtatgcg gggaaaggac       660
     tggggaccta tctacgctga cgacaaatcg gccaacgtga cgtctgaccg catgatcaag       720
     gtggatatgt ctagtatgcg ccacaacaag tggtctaatc tgtcgttacc ggcgcatgtt       780
     cctgcgcggg ctaatggtga gctcgtttgg gttcctgtcg ccgagtccgg ggttttggtg       840
     gcgattgggg gagtgattaa tccagccacg atcttctcgt cggacgggtt gacaagtgcc       900
     cagcagaatg cgagtaagcg tgtaagccca gggcttatgg agacagtgtc tgtttacgat       960
     gtcagcggtg ataaatggta tctgcaaaac accaccgggg atatcccccc tcagttgacg      1020
     cagttctgct cgattcatgc gagtgcacaa gacggctcct cacataacat ctatatttac      1080
     ggcggctacg acgggctaag catggagaac acgccgtccg acgatgtcta cgtcttatct      1140
     ctgccctcct tcagttggat caagctttac agcggaaata ctacccatgg ccggagtggt      1200
     caccgctgtg ttaaaccata tccggaccaa atgctggtcc tcggaggcgt tcatcttgac      1260
     ccgacgcatt gtctcgacgg tggagtgatt caagtgttca acctgaatac tggcaggttc      1320
     caaaacacct acaatccgaa cgtctggaac gagtacaaag tcccggacct gatcactact      1380
     gtcatcgggg gagactccga aggtggcgcc acaaaagcat cacccatttc ctggaccaat      1440
     gcctctttgg cagatgtgtt caaaaccaag tacaccaaca ccattagtac ctggtacccc      1500
     tacaacagca ctagcagcat ctcacccacc attgcccccg ccgcggacaa agggtccagc      1560
     ttccccaagt gggcgagcgc catcatcggt gttattttag ggttcctttt catctcagca      1620
     gcggcgatat tctggtttct ccgtcgccgt cacaagctcc gagaatcaca atctacaggt      1680
     gatcgatcaa cccgatcctg gattctacgg tggttgcaca ccagcgggtc ggcaactggc      1740
     gtgccgaaat ccggcgacac gacagcgcca acggggtaca gcgtatttac gaatgagtca      1800
     actatcactc cagcaacagc agtatcaccg cagagcgtgg aggcaggtag cgatcccgta      1860
     tatgagatgc taggtcagtt tttcaatctc cttttccttt accccgctaa ccactgcgaa      1920
     ggtcatgcta cgacactccc tgtggaactt cccacgccgt acaacaataa ttccctcccc      1980
     agtccagttt cgccccctgg cgtttcgggt acggactatg tatctcctat cacggttagc      2040
     acgcccagta cagaggatga agcgagcccg gttagaccgc ctcattatcg ccacatgtct      2100
     agtttgtcta gtgtgccgac tatagcgaat gtgatgcgca aggagagtcg ccaccggcag      2160
     acatataggt cggatacgtc ggaaggaagc gttgagcttg agtgtccgag gggtgtggag      2220
     ctgagcggta gcactcctca ggaagggaga ttggcgacaa caagagaggt tgatgagctt      2280
     gagggtttgg gaataaaggc attaccgtag                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page