(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE382

ASFUM1_4.PE382       Location/Qualifiers
FT   CDS_pept        join(complement(1519896..1519983),
FT                   complement(1519722..1519843))
FT                   /codon_start=1
FT                   /gene_family="HOG000187641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260062"
FT                   /orf_name="AFUA_4G05985"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27396.1"
FT                   /db_xref="UniParc:UPI0000F51C03"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N5"
FT                   /transl_table=1
FT                   /translation="MSTTRLRKAFRYPDDSGDDEQGREELDEEEQDVVIRQLQAENDQR
FT                   NSEYTVKTPLSSLTLLSTETRAKP"
     atgtctacta caagacttcg caaagcgttt cgataccctg atgattcagg tgacgatgaa        60
     cagggccgag aagagctaga cgaagaggaa caagacgttg taattagaca attacaggca       120
     gagaatgatc agcggaattc tgagtatact gtgaaaactc ccctatcctc gttgacactt       180
     ctcagcacag aaaccagagc taaaccatga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page