(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE384

ASFUM1_4.PE384       Location/Qualifiers
FT   CDS_pept        join(complement(1521306..1522161),
FT                   complement(1521143..1521240))
FT                   /codon_start=1
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206599"
FT                   /orf_name="AFUA_4G06000"
FT                   /product="50S ribosomal protein L3 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL90186.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG054274"
FT                   /db_xref="HOGENOM:HBG734653"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI0000F51C2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ8"
FT                   /transl_table=1
FT                   /translation="MLQGRDCFEYHSIIGQTILTMSPRLSRKLTQLPTLFLGLPSLTIT
FT                   GNVSVRSFGIKSLNPPKPSRFNIGPELPVLKSTSTAALERKANTLPLRTGAIAIKKGMT
FT                   AVYDAETGKRIACTVLQLDRVQVVSHKTRQTHGYNAVQVGAGWKHPSNVTKSLLGHFST
FT                   NGVSPKRHVYEFRVKDESGLLPVGQTINADWFQEGQYVDARSYSKGKGFAGVMKRHGFH
FT                   GQDRSHGVSLTHRSLGSAGPSQGGGSRVYPGKKMAGNMGNEQNTVQNLKVLKVDADNGI
FT                   VVVNGSVSGPKGCVVRIQDAIKKPWPEIAHVSKTAA"
     atgctgcagg gacgagactg ttttgagtat cattcaatca tcggtcaaac gatactcacc        60
     atgtcgcctc gactgtcaag gaagctgacg cagcttccta ctctcttcct gggtcttcca       120
     tcgctcacta tcactggcaa tgtgtctgta cgatctttcg gcataaaatc attaaatcca       180
     cctaaaccct ctcggttcaa tatcggtcct gaattacctg tgcttaagtc gacttccacg       240
     gctgctttgg aacgaaaggc gaatactcta cctcttcgga ccggtgccat cgctatcaag       300
     aaaggaatga ccgctgtata cgatgccgaa actgggaaac gcatcgcttg cactgttctg       360
     caactcgatc gagtacaagt cgtctcacac aagacaagac agacgcatgg gtataatgcc       420
     gttcaggtcg gtgccggttg gaagcatccc agcaatgtga caaagtcact cttaggccat       480
     ttttcgacta acggtgtctc gccaaagaga cacgtttacg agttccgtgt caaagatgag       540
     agtggcctct tacctgtcgg ccaaacaatc aatgcagact ggtttcagga aggtcagtat       600
     gtcgatgccc ggtcttactc taagggtaag gggtttgccg gtgtgatgaa gcgacacggc       660
     ttccacggac aggaccgcag tcacggtgtc agtttaacac atcggtcact tggttcagcc       720
     gggcctagtc aaggtggtgg ttccagagtg tatcccggaa agaaaatggc gggaaacatg       780
     ggtaatgagc aaaataccgt gcagaacttg aaagttctca aggttgatgc agacaacggt       840
     attgtcgttg tcaacggttc cgtcagcggg cctaaaggat gcgtagtcag gattcaggac       900
     gctatcaaaa agccttggcc agagattgca catgtatcca aaacggctgc atag             954
//

If you have problems or comments...

PBIL Back to PBIL home page