(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE385

ASFUM1_4.PE385       Location/Qualifiers
FT   CDS_pept        join(1522634..1523243,1523324..1523475)
FT                   /codon_start=1
FT                   /gene_family="HOG000187663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260063"
FT                   /orf_name="AFUA_4G06010"
FT                   /product="Peptide alpha-N-acetyltransferase Nat2, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL90185.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG054273"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniParc:UPI00005200C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ9"
FT                   /transl_table=1
FT                   /translation="MSLKFITTPRWFSHLIGQAGHAPSLSFVRKNVTSSQGLFTPNIVA
FT                   SFPSRRAFASSPAWKSNPQYRFFPRQSGSTTTFTYNPPSTLQRSIFRRFNSSRANQSAR
FT                   PAESGSLSQRLKKLSREYGWAALGVYLLLSAMDFPFCFIAVRHLGAERIGHYEHVVVET
FT                   VKGLFGAKSAPEEQSQEEVSAPRPVQQTTEAQKKNNGDGPSLWTQLALAYAVHKSLIFI
FT                   RVPLTAAITPKVVKVLRVWGWDLAKRRPRGM"
     atgtctttga aattcataac cacaccacgg tggttttcgc acctcatcgg tcaagccggt        60
     catgcgccct cattatcttt cgtcagaaag aatgtcacat cttcacaggg actgtttacg       120
     cccaatatag ttgcttcatt cccgtctcgt cgagcatttg cttcctcccc cgcttggaag       180
     tccaatccac aatatcgatt cttcccccgc caatcggggt caactactac ttttacatac       240
     aatcccccca gcactctgca acggtcaatc ttccggcgat tcaactcatc gagggcgaat       300
     caatccgcac ggccggctga gtcaggctct ctatctcagc ggctgaagaa gctgtccagg       360
     gagtatggct gggctgcact gggtgtttac ctgctgttat cagccatgga ttttcccttc       420
     tgtttcattg cggtccgcca tttgggcgca gaacgaatag gccactatga acatgttgtc       480
     gttgaaacag tcaaaggctt attcggagca aagtctgcac cggaggaaca gagccaggag       540
     gaggtctcag ctccccggcc tgtccagcaa accacagaag ctcagaagaa gaataatggc       600
     gacggcccca gtttgtggac tcagctcgcc ctggcgtatg cagttcacaa gagcctcatc       660
     ttcattcgcg tacccctcac cgctgccatc accccaaaag tagtcaaggt cctaagagta       720
     tggggctggg acctcgcgaa gcggaggcca aggggcatgt aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page