(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE39

ASFUM1_4.PE39        Location/Qualifiers
FT   CDS_pept        join(129266..129397,129444..131133,131190..132478)
FT                   /codon_start=1
FT                   /gene_family="HOG000216777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905470"
FT                   /orf_name="AFUA_4G00500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84368.2"
FT                   /db_xref="HOGENOM:HBG054116"
FT                   /db_xref="UniParc:UPI0000F51C16"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W973"
FT                   /transl_table=1
FT                   /translation="MQFSRAICLVCIAAYSPVLSAVLAEDVTVTETVLETVTVSEPWEA
FT                   ATSLPTSATAYSAVAETSTSPAELRLDTPTVLLPTSSSAYWLIPGPSPILGAETSTSTT
FT                   ITPPAYTLRKRANPPKSPAIIARAPATITVTSTSTVTTCPVCTNTPTTTSTNTPTITPP
FT                   ETTPTTSTITSTPVTTPTVGPGSTVTTTVTVTTTAPGPTETDTVTTTVGLPGTTETDTL
FT                   TSTVTIPGTTGTDTVTTTIDLPGATVTATQSSTSTITITATTTQSGTTCAATPGDGITQ
FT                   TTTVTVSSEGATTMTLTQTVTLPATTVSNAATLTEATSVAMSGFTLTVPGSTVTETTTS
FT                   TKITTQTVTVSGSTVTGITTVTRTSTSTVTSPGSTVTGTTTLTKISTSTLTSLGVTVTD
FT                   TMPVTEGSIQTISQILTMTAIKTEVLPGTTVVDSKTITLPGTTIVNSKAVTLTVPGTTV
FT                   TTMRTITKSGTTMTISEVVTLPGSTVTTIETVPTTLSGSIIVTTTTKPGQTITMSGSVT
FT                   TLPGSTIIQSSTLPSVTTTDLQVIPTTLPGAMILTTVMRPASTMIVSGTITTLPGSTIV
FT                   QSATLPGLRLVETVSVTVIQSTTIFDTVTLTGFDKTITTTEPAASTAQSGNTVTVPTTT
FT                   TTLFICPTLSINPTYTPVAPLPRNYTWGCPPGYLCKTKHTGADAGCNIEASMPAESYVC
FT                   SPDECIKSPPFIHDQYWGTPVESNEIRSSYNISKDYFNLDPEIFGLNYSIFRIPDLKPG
FT                   DDHYYIRSSRRTWSKLLARQSIGVSTVPGACYDECNDAALEVESTGKTPDICNAGSAFN
FT                   VSLGQCEKCCNTHKTATSASFEQKVLPNFQQFLNFCEGLEDSATTAAADTVGSTTKGSQ
FT                   TSTTPGTTSTQEGGTMSQADPLTASSTSNFTGKATKSRDKSSTAASATSIEQTIIPSPT
FT                   QQTTAPHPMTESKPVTASEISTDTISSSSSCSATGTSSRETAQSSSASENTGNSAATST
FT                   SHRPTSTHSGASPSAPALLFTGAASLQTVPSHWGILAFIFGVVGFHI"
     atgcagtttt cgcgcgcaat ttgtctggtc tgcatagcgg cctattcccc agtattgagt        60
     gctgttttag cagaagatgt gacagtaaca gagacagtgc ttgaaacagt cactgtttct       120
     gaaccttggg aggcagcaac cagcctaccg acgagtgcta cggcatactc agcagtggcc       180
     gaaacatcaa catcacctgc tgaattgcgg ttagacaccc ccacagtgtt attgccaacg       240
     agctcctcgg catactggtt gattccagga ccatcaccga tcttaggcgc agagacaagc       300
     acttcgacta ctattacacc accggcatat actttaagga agagggcaaa tcctccaaag       360
     tcgccggcca taatcgcaag agcccctgct acaatcacag taacttcgac atcaacagtc       420
     acaacctgtc ctgtgtgtac gaacacacca actactactt ctaccaacac gccaacaata       480
     acaccccctg aaactacacc aacgacatcc acaataacca gtactcctgt caccacgccg       540
     acagtaggac caggatctac tgtaactacg actgtgactg tgacaaccac tgctccaggc       600
     cctacagaga ctgacactgt caccacgact gtcggcttgc caggcaccac ggagacagac       660
     accctcacta gcacagtcac tattccggga actacgggaa cagatactgt cactacaacc       720
     attgacttac ctggtgccac agtgacagcc actcagagtt caacctcaac cattactatc       780
     acggctacca caactcagtc agggactacc tgcgctgcaa ctccaggcga tggaataacc       840
     caaaccacca cagttactgt tagttctgaa ggtgcaacga ccatgacatt gactcagaca       900
     gtaactctac ccgccacgac ggtgtccaac gcagctacgc ttacagaagc tacatcggta       960
     gcaatgtcag ggtttacttt aacagtccct ggttcaactg taactgagac gactacatca      1020
     accaagatca ctacacaaac tgtcactgtt tctgggagca cagtaacagg tatcacgaca      1080
     gtgactagga cctcaacatc aacagtcact agtcctggat caaccgttac aggcacaacc      1140
     acattaacta agatttcgac ctcgacactt acaagtctag gagtgacagt tacggataca      1200
     atgcctgtaa cggaaggttc tatccagacc atcagtcaga ttctaacgat gacggccatc      1260
     aagaccgagg tcttgcctgg gacaaccgtg gtagattcaa agacgattac cctacctggg      1320
     acgacaatag tcaactcgaa agctgtgacg ctcacggtcc caggaacaac tgtgactact      1380
     atgaggacaa tcactaaatc tgggacaacg atgactatct cggaggtagt cacccttcct      1440
     ggttccacag tcacgacgat agagacagtt ccaactactc tctccgggtc aatcatagtc      1500
     acgacaacca ctaagccagg acagacgatt accatgtccg gatctgtaac cacgttgcct      1560
     ggatcgacta ttatccaaag cagtactctt cctagcgtga cgacgacgga tctgcaggtc      1620
     attcccacaa cactgcctgg agcaatgatt ttgaccactg ttatgcggcc agcaagtacc      1680
     atgatcgtat caggaactat tactactcta ccagggtcaa ctattgtaca aagcgcaact      1740
     ctccctggat tgcggttagt cgagactgta tcagtgactg tcatccagag tactactatt      1800
     ttcgatacag taacgttgac tggctttgat aaaactataa caaccacaga accggctgca      1860
     tctacggctc agagcggcaa cactgtaaca gttcctacaa ccaccacaac gttattcatt      1920
     tgtccgaccc tcagcatcaa tcccacttac actccggtcg ctcctctccc aaggaactat      1980
     acttggggtt gtccaccagg ttatctttgc aaaaccaaac acacaggtgc cgacgcaggc      2040
     tgtaacatcg aagccagcat gccggcagag tcctatgtct gcagtccaga cgagtgtatc      2100
     aagagcccgc cattcatcca cgaccagtac tggggcacac ctgtcgagtc caacgagatc      2160
     cgttcatcct acaacatctc aaaggactac ttcaacctcg accctgagat cttcggtctg      2220
     aactactcca tctttcggat ccccgacctc aaacccggcg atgaccatta ctacatccgg      2280
     tcttctcgcc gaacgtggag caaattactt gcccggcagt caattggagt atccacagta      2340
     cctggcgctt gctatgacga atgtaacgat gcagcattgg aggttgaatc gaccggcaag      2400
     acacccgaca tatgcaacgc tgggtcggct ttcaatgtct ccctgggcca atgcgagaag      2460
     tgctgtaata cccacaagac agctacttct gccagctttg agcaaaaggt tctgccaaac      2520
     tttcagcagt ttttgaactt ttgtgagggg ttggaggact cggctaccac tgcagctgcg      2580
     gatactgtcg gttcgactac taagggtagt cagacatcta caacgccagg aacgacatcc      2640
     acgcaggaag gcggtactat gtcacaggct gatccattaa cagcgtcgtc tacctcgaat      2700
     tttaccggca aggccaccaa gagtcgtgat aaatcaagca cggccgcatc tgcaacctct      2760
     attgaacaaa caataatacc ctcaccaacc cagcagacaa ccgcaccgca cccaatgacg      2820
     gaatcgaagc ctgtaaccgc gagtgagatc agtacggata ctatctccag ttcatcatca      2880
     tgctcagcga caggtacctc ttcgagagag actgcacaaa gttcttccgc aagcgagaac      2940
     actggtaaca gcgcggctac ttcaacatct cacagaccaa cgagtacaca ttccggagca      3000
     agtccgtctg cacctgcatt acttttcaca ggtgcggcaa gtctccagac agtgccatct      3060
     cactggggta ttttggcttt catttttgga gttgtgggtt tccacatctg a               3111
//

If you have problems or comments...

PBIL Back to PBIL home page