(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE392

ASFUM1_4.PE392       Location/Qualifiers
FT   CDS_pept        join(1554397..1554593,1554689..1554985,1555094..1556246)
FT                   /codon_start=1
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750024"
FT                   /orf_name="AFUA_4G06080"
FT                   /product="MFS myo-inositol transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90178.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054265"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F9F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK6"
FT                   /transl_table=1
FT                   /translation="MNRGDANDELAPDAPLLSTEQVGVDGTAHFAADSQSLSLDLRDSG
FT                   SLFIWALTFSAGISGLLFGYDTGVISSTLVSIGTDLSNRVLTTLDKSLITSCTSLFALL
FT                   ASPLAGILADKLGRRRVILVADVLFTLGALVQAVTGQVWGMVLGRSVVGLAVGAASLVT
FT                   PLYISELAPSHARGRLVTILCLFITGGQVVAYIVGWLFSTITSGWRWIVGLGTLPAVLQ
FT                   FVIVVALPETPRWLVQAGLEAEALHVLSKVYQGQSDNHQIAKQVVRSIQLEVAEEQEEM
FT                   DRIKPSVDATRIPWLRKVAQRAQDLFLVGGNRRALIIATMLQGLQQLCGFNSLMYFSAT
FT                   IFSMLAFSSPTLTSLSVAVTNFIFTLLAFALIDRIGRRRILLYSIPVMSASLIVCALAF
FT                   GSMELPGFSSEPRSQTQADNGATDKSFLPIAVLLCLTVYTASYAFGLGNVPWQQSELFP
FT                   LNVRSLGSALATATNWASNFIVGLTFLPMMDWLSPGWTFTAYAGVCVVGWFGVWAIYPE
FT                   MSGLSLEEVRGLLANGWGVRESLSRNRYSAS"
     atgaatcgtg gtgatgcaaa cgatgagttg gcgcccgatg cccctttgct ttcgacagag        60
     caagtgggcg ttgatggcac cgctcacttt gctgctgata gtcagtcctt gagcttggac       120
     ttacgggact caggcagcct gtttatttgg gccttgacgt tctcagccgg tatcagtggc       180
     cttctgttcg gttatgatac aggtgtcatc tcttcaaccc tcgtgtccat tggcactgat       240
     ctctcaaatc gtgtcctgac gaccctagac aagagcctga tcacatcttg cacgagcctc       300
     ttcgctttat tagcaagtcc cttggcagga atattggccg ataagctcgg tcgtcggaga       360
     gttatacttg tcgcagacgt tctatttact ctgggagcct tggtacaggc cgttaccggt       420
     caagtatggg gcatggtact tgggagaagt gttgttggtc tagccgtcgg tgccgcgagc       480
     ctggttactc cattatatat ctctgagttg gcgccttccc atgcccgagg gagactcgtg       540
     actatcttgt gcctcttcat cactggtggt caggttgtag cttacatcgt tggctggcta       600
     ttctccacaa tcaccagtgg ctggcggtgg attgtcggcc ttggaactct cccggctgtg       660
     ctgcaattcg tcattgtcgt tgccttaccc gaaactcccc gatggctggt ccaagcgggg       720
     ctggaggcag aggctctcca tgtattgtcc aaggtctatc agggccagtc tgacaaccat       780
     caaattgcta agcaagtcgt gcgaagtatc cagcttgagg tagctgaaga gcaagaagag       840
     atggaccgca ttaaacctag tgtcgatgcg actaggatac catggcttcg gaaagttgcc       900
     cagcgcgctc aagatctttt tctcgttggt ggaaacagaa gggcattgat aatcgcaacc       960
     atgctgcaag gactacagca actttgcggc ttcaacagtc tcatgtattt ctcggcgact      1020
     attttctcca tgctcgcatt ctcctcgccc accctcacgt ctctctctgt ggctgtgacc      1080
     aattttattt ttacgctgct ggcgtttgcg ctgatcgata ggattggccg gcgtcgcatt      1140
     ctgttatatt caatacctgt catgagtgca tcactaattg tctgcgcctt ggctttcggc      1200
     tccatggagc tgccaggatt ctcttctgag ccgcgatcac aaacccaagc cgacaatggc      1260
     gccacggata agtcgtttct tccaattgct gtgcttctct gcctcactgt atataccgcc      1320
     tcctatgctt tcggactggg caacgtgccc tggcaacagt cagagttatt tcccctgaat      1380
     gtgcgttctc ttggatcggc tctcgcgact gcaacgaact gggcgtcaaa tttcattgtc      1440
     ggacttacct tcttgcccat gatggattgg ctttctccgg gttggacatt tacagcctat      1500
     gccggcgttt gtgtggttgg atggtttggc gtctgggcca tttaccccga aatgagcggt      1560
     cttagcctgg aggaggtcag aggacttctc gccaacggtt ggggtgtcag ggaaagtttg      1620
     tcaagaaatc ggtacagtgc aagttga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page