(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE393

ASFUM1_4.PE393       Location/Qualifiers
FT   CDS_pept        join(1557048..1557185,1557238..1557678,1557740..1558006,
FT                   1558270..1558731)
FT                   /codon_start=1
FT                   /gene_family="HOG000187719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206600"
FT                   /orf_name="AFUA_4G06085"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27395.1"
FT                   /db_xref="HOGENOM:HBG324373"
FT                   /db_xref="UniParc:UPI0000F51BF6"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N4"
FT                   /transl_table=1
FT                   /translation="MPRMRGSHDSAKYIDTHGHHWEMSRQKTDPRARSHNASPLLLLPT
FT                   EILQYIAYLLPSDVDIVNLVSCCVHLARAILPAHSSIWRERFKDLYGTPQRRSSSELKL
FT                   EYQIRSIVLSQKINFRYGQKQEQTLWLEVLRDMLLEAYESAPTDEHTASKLLEQIHKTL
FT                   HNSEFLNRPVSGYGDTNTDAPSELFYAVQLCLTHLVLDPSMAVYCLRNDYDIGAVYSFQ
FT                   VDISEPLVNVEKLDLGKILHIRNFWLRHLLNPNEATFCSSYTLLHQRPNATRSLGDSRC
FT                   CSLRIKLDPDPSNWPTLFDSIIPILGSRTSCSYFRGIETQHGSDDDSTYLVRGFTEVIP
FT                   KAHGGFPYWRRICFAIYDADREQLPLIPNDDGTSGKGKDDLWLPEEAWPPYDLEVEFNW
FT                   VHGYEGVILPSGTIMIGRWIDMVEPTARGPFIFWNV"
     atgcctagaa tgcgcggcag tcatgattca gctaagtaca ttgacactca tggccaccat        60
     tgggaaatga gccggcaaaa gacagaccca cgagctcgga gtcataacgc aagtcccctg       120
     ctgctgcttc ccacagagat acttcagtat attgcatacc ttctcccgag cgatgtcgat       180
     atagtcaatc tggtgtcgtg ctgtgttcac ctagctaggg cgatcttacc ggctcactcg       240
     tccatctggc gggagcgatt caaggacctt tacggtaccc ctcagagacg ttcttcaagt       300
     gagctcaaac tggagtatca gattcgttcc attgtgctgt ctcagaagat caacttccga       360
     tacggccaga aacaggagca aacattgtgg ctggaagtgc tgagagacat gcttctggaa       420
     gcatatgaat cagccccgac agatgaacac actgcttcca aactcctcga gcagattcat       480
     aagacactcc acaactcgga attcctgaac cgacctgtaa gcggatatgg tgacacgaat       540
     accgatgcgc cttctgagtt attttacgct gttcagctat gcctcaccca cctggtgttg       600
     gacccgtcta tggccgtcta ttgcctcagg aatgactatg atattggcgc cgtgtattca       660
     ttccaagtcg atatcagtga gccgcttgtg aatgtagaga agctggatct ggggaaaatt       720
     ttacatattc gcaacttctg gcttcgtcat ctcctcaatc cgaacgaagc gacattctgc       780
     tcctcgtata cactgctgca tcaacgaccg aatgccacgc gatctctggg cgacagcaga       840
     tgttgctctt tgcgcatcaa gctagatcct gacccgtcaa actggccgac cttattcgac       900
     agcatcatcc ctatcctggg gtcgagaacg agttgctcgt actttcgcgg cattgaaacg       960
     cagcacggat ctgatgacga ttcaacatac ctggtgcggg gcttcacaga agttatccca      1020
     aaggctcacg gtggcttccc ctattggcgc cgtatatgct ttgccatcta cgatgcggac      1080
     agggaacaac tcccgcttat accaaacgat gatgggacat ctggaaaggg aaaggacgat      1140
     ctatggctcc cggaggaagc gtggccgcca tatgatttgg aggtggaatt caattgggtc      1200
     catggatacg agggggtcat tcttcccagt ggaacgatca tgatcggacg atggattgat      1260
     atggttgaac cgactgcccg aggtcctttc attttctgga atgtgtga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page