(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE396

ASFUM1_4.PE396       Location/Qualifiers
FT   CDS_pept        join(1563138..1563818,1563891..1563935)
FT                   /codon_start=1
FT                   /gene_family="HOG000187741" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750025"
FT                   /orf_name="AFUA_4G06110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90175.2"
FT                   /db_xref="HOGENOM:HBG054262"
FT                   /db_xref="HOGENOM:HBG324371"
FT                   /db_xref="UniParc:UPI0000F51BCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK9"
FT                   /transl_table=1
FT                   /translation="MLLCLYRNMLPPSDSFLHHSHKLREVAANARNRAVRIPPPPYSLA
FT                   VPRGSTHEEGQNALETIDDDTAWETCAGASSTPITISIDASINVVGNGNTIMIPSMAGH
FT                   PQQTPKVSSSMSPESSSSSSSIAPAASEADTLHSIQKQRQARLTEMATAIINTLYDSGR
FT                   LAPPAEDHEHAPLEIKINTGIKVEGSRNVICVGATARAQSNKSAPMGTDKDRQVILNRK
FT                   RRALSEPFEAPNSKKNCVQ"
     atgttacttt gcttgtatag aaacatgctg ccaccgtcag attctttctt gcatcactct        60
     cacaagcttc gagaagtagc cgctaatgcg cgcaaccgtg cggtccgcat accaccacct       120
     ccgtactctc tagcagtccc acgaggttca actcatgagg agggacagaa tgcgttggag       180
     accatcgacg atgacacggc ctgggaaacc tgcgccggtg ccagctccac tcctattacg       240
     attagtattg acgcttccat aaatgtggtg ggcaacggca acaccatcat gatcccgtct       300
     atggcaggtc atcctcagca aactccgaaa gtttctagtt caatgagtcc cgagagttca       360
     tcctcctctt cgtccattgc accagcagcc tctgaagcgg acactctgca ctcaatccaa       420
     aagcaacgcc aggctagact caccgaaatg gcaaccgcca tcatcaatac cctgtacgac       480
     tcgggccggc tagcacctcc ggcagaagac cacgaacatg caccgcttga aatcaagata       540
     aacacaggga tcaaggttga ggggagccgc aacgtcattt gcgttggtgc tacagcccgg       600
     gcccagagca acaagagcgc cccgatgggc acggacaaag atcgacaagt gattttaaac       660
     cgaaagagac gagctctatc agagcctttc gaagcaccga actccaagaa gaattgtgtg       720
     caataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page