(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE397

ASFUM1_4.PE397       Location/Qualifiers
FT   CDS_pept        join(complement(1566441..1566784),
FT                   complement(1565180..1566352),complement(1565031..1565115),
FT                   complement(1564873..1564971))
FT                   /codon_start=1
FT                   /gene_family="HOG000187752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902017"
FT                   /orf_name="AFUA_4G06120"
FT                   /product="RSC complex subunit Sfh1, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin remodeling"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="EAL90174.1"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054261"
FT                   /db_xref="HOGENOM:HBG324370"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI000051F50A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL0"
FT                   /transl_table=1
FT                   /translation="MSPLRGYITSYPPRIRQYGNALLTPVIPQTQVGPTPRTTKRGTTA
FT                   VNYAEDGFDDDDFEDSEGPRRPTGLRSLRREESATDKTPLAEKLGKEIHAPVEVQGVFR
FT                   DWMIKRMLRPACADQLQIQAQLPLTLIPIRIDLEVPAHQPLEPFPMPRGVVDPGINPTL
FT                   PGYRRPDPLPAFRIKDTFLWNLHEALATPEEFAMGFVRDLDLPNPQAMTLAISNQIRQQ
FT                   LEEYAGVALHPLFQSTQSSKPAPTSQTNPSRDVSATPVPTQAATPDNRAIGVSVTKEAL
FT                   VNDSILNPDDAYRCLINLNINLQNRLYTDKFEWSLLHPPGMAEEFAQVTCADLGLGGEW
FT                   VGAIAHGIYEAVLKLKKEVCESGGMISGMGGYGNEIDNQAANGTEAGWRYDPEGLGDEW
FT                   EPKVETLSKEEIEKREGDRERQIRRLRRETARFSSTAGITPDMSRQGSGYFDVDSETPL
FT                   GRGERSKRKRRFRSLSPSGRGGTPGGRGTPDTGSGAGYGGGGGTLSDWERQSWRCSNCM
FT                   VWGSAVWAVRDGPAGPRTLCHNCGLLYERDKVTPEWSRDLHRHDVPVGR"
     atgtcccccc tcagaggcta tatcacgtcc tatcctccgc gaatacgcca gtacgggaac        60
     gcattactca cgccagtcat tccgcagact caagttggtc cgacgccgcg aacgacaaaa       120
     cgaggcacta ctgcggtgaa ctatgccgag gatggcttcg acgatgatga ctttgaggac       180
     agtgaaggcc ccagaaggcc cacaggtcta agaagtctac ggcgcgaaga gtcggcaaca       240
     gacaagaccc ccctggcgga gaagttggga aaagaaatcc atgctcctgt ggaggttcag       300
     ggagttttcc gcgactggat gattaagagg atgttgcgac cagcttgtgc cgaccagcta       360
     caaattcaag cgcaactccc cctgactctc atcccgattc gtatcgactt ggaggtccca       420
     gcgcatcagc ctctcgagcc atttcccatg ccgcgtggcg tggtggatcc cggtatcaac       480
     cctacccttc ccggatatcg aagaccagat cccctgcccg ccttccgcat caaagatacg       540
     tttctgtgga accttcatga agctctggcg actcctgaag aatttgccat gggcttcgtg       600
     cgagacttgg acctaccgaa ccctcaagcg atgactctgg caatcagcaa tcagatacgc       660
     cagcagttag aggagtacgc gggtgttgcg ctacatccat tatttcaaag tacacaatcg       720
     tcgaagcccg ctccgacttc gcagacaaat ccatctcggg atgtgtccgc aacgccagtt       780
     cctacgcaag ctgcaacacc agacaacagg gcgattggtg tttcggtaac aaaagaagca       840
     ctagttaacg acagtatact aaacccggat gatgcatatc ggtgcctaat caacctcaac       900
     atcaatctgc agaacaggct gtacacagat aagtttgagt ggtccttgtt acaccctccc       960
     ggcatggcag aggaattcgc gcaggtcacc tgcgccgacc taggcctggg cggcgagtgg      1020
     gttggagcca ttgcgcatgg tatctacgaa gctgtcttga aattgaagaa ggaagtgtgt      1080
     gagagcggag ggatgatcag tggcatgggt gggtatggaa atgagatcga taaccaagct      1140
     gccaatggca ccgaggctgg ttggcggtat gatcccgaag gactaggcga tgaatgggaa      1200
     cctaaggtag agactctttc aaaggaagag attgagaagc gagaaggaga ccgcgagcgc      1260
     cagatcagac gtctacgacg agaaacagcc cggttctctt ccaccgccgg catcacacca      1320
     gatatgtcgc ggcagggcag tggttatttc gacgtcgata gtgagacacc gctgggtaga      1380
     ggagaacgta gcaagcgaaa gaggcgcttc cgcagcctca gcccgtcggg aaggggaggc      1440
     actcctggtg gacggggcac accagatacc ggttcggggg ctggatatgg cggaggtgga      1500
     ggtacattat cggattggga acgtcagagt tggagatgca gcaactgcat ggtatggggt      1560
     tctgcggtct gggcagtacg agatggtcct gctggtccaa ggactctttg ccacaattgc      1620
     ggcctattgt acgaacgtga caaggtcacc ccggagtggt caagagattt gcatcgccac      1680
     gatgtaccag ttggtcggta g                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page