(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE4

ASFUM1_4.PE4         Location/Qualifiers
FT   CDS_pept        join(complement(30020..30109),complement(29730..29831))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905460"
FT                   /orf_name="AFUA_4G00130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84405.1"
FT                   /db_xref="HOGENOM:HBG054316"
FT                   /db_xref="UniParc:UPI000051F74A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W936"
FT                   /transl_table=1
FT                   /translation="MQWLFSRQDLTQLTVRAYWTAPSPPCRVAVIDFTITKYPSDAIYT
FT                   YMTTSSVIPSSLQALTLR"
     atgcagtggc tattcagcag acaagatctc acacaactta cagtacgtgc ttactggaca        60
     gctccgagtc caccttgtcg agtagctgtg atcgacttta cgataacaaa gtaccccagt       120
     gatgccatct acacttacat gacaacatca tctgttatac caagctccct tcaagccttg       180
     acactgcgtt aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page