(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE402

ASFUM1_4.PE402       Location/Qualifiers
FT   CDS_pept        join(1585417..1585591,1585658..1586220,1586301..1586432)
FT                   /codon_start=1
FT                   /gene_family="HOG000187797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260069"
FT                   /orf_name="AFUA_4G06170"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL90169.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG054255"
FT                   /db_xref="HOGENOM:HBG324366"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI0000F51C32"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL5"
FT                   /transl_table=1
FT                   /translation="MHRSSNNSYHQSSSSRSSSAHSSSSAFSPNANPNEDWTKISDLAE
FT                   RRRIQNRIAQRNYRKKLKRRLEDLEKRAASASESPERSHEKPELPKHANPGKSSSRTSR
FT                   SSKSNLETSHGSRERLPLYDCYNSQDDRGAMFSHQCTRQLSASPPPVFSYPSYPHLDPY
FT                   RQSNYGTSPAYSSTYNDLSSFQGEYGNPVPSIMPVAMSSGGPLKRPHTYADEEIISPFS
FT                   MSYATMAGIDLCPTSHHPGESNISIPSLCQLFAEDLSSPPTPAETSILTCPLTPESDPC
FT                   SPHSFPFL"
     atgcatcgct cttcgaacaa ttcgtaccat cagtcttcga gctcccgaag ctcgtccgcc        60
     cacagctcta gcagtgcttt cagtcccaat gccaacccta acgaggactg gacaaagatc       120
     tcagatcttg ctgaacgtcg acggatacag aatcgcatcg ctcagaggaa ctaccgcaag       180
     aaactgaagc gtcgcttgga ggacttggaa aagagggctg cctctgcttc agagtcgcca       240
     gaacggtccc atgagaaacc ggagttgccg aagcatgcga atcctggcaa gtccagtagc       300
     aggacaagcc gctcgtccaa gtcaaacttg gagaccagtc acggctccag agaacgcctt       360
     cctctttacg actgctacaa tagccaagac gaccggggtg ccatgttctc tcaccaatgc       420
     accaggcaac tgtcagcgtc acccccccct gtgttctcat atccctcgta tccgcacctg       480
     gacccctaca gacagtccaa ctatggcacc tctcccgcat acagttcgac ttacaatgac       540
     ttgtcgtcct tccaagggga atatggaaac ccagtgcctt caatcatgcc ggttgcaatg       600
     tcttcaggcg ggccactgaa gaggccacat acatatgcgg acgaagagat catcagtccc       660
     tttagtatga gctacgcgac tatggccggc atcgacctat gtccgacttc tcaccatccc       720
     ggtgaatcta atatctctat cccatctttg tgtcaattat ttgctgagga tctctcctct       780
     ccgccgacac ccgcagagac gtccattctc acgtgtcctc tcacacccga gtccgacccg       840
     tgctccccgc attcgtttcc ctttctgtga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page