(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE403

ASFUM1_4.PE403       Location/Qualifiers
FT   CDS_pept        complement(1590604..1591698)
FT                   /codon_start=1
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260070"
FT                   /orf_name="AFUA_4G06180"
FT                   /product="Casein kinase II beta subunit CKB1 "
FT                   /EC_number="2.7.1.-"
FT                   /function="kinase activity"
FT                   /function="protein kinase regulator activity"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="EAL90168.1"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG054254"
FT                   /db_xref="HOGENOM:HBG736305"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniParc:UPI0000520314"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL6"
FT                   /transl_table=1
FT                   /translation="MSSSEGAPESWISSFCSLMGHEFFAEVSEDFIEDDFNLTGLQSQV
FT                   PMYKEALEMILDVEPEEDEDEEEEEEEEEEDDDEILGDERPPGYRRAGDRRHARVASDL
FT                   SVIESSAELLYGLIHQRYITSRPGIQQMLEKYEMQHFGVCPRTYCNGSKVLPVGCSDTP
FT                   GQETVKLFCPSCQDLYTPPNSRFHSVDGAFFGTTFGYLFFMTFPDLDIGPRLDPSMLTA
FT                   APTNANNQSRSSSLTSGVNRATPDLPPPPPNQPTEINGVRTSNFCPGLGPGRIYESKIY
FT                   GFRVSERSRVGPRMKWLRMKPADIRELDELAQYEAIHGSANDGGDTEMNIEAQNAAAIA
FT                   ARKKAPMRRRRHHPDQMSINGAEG"
     atgtcgtctt cggaaggggc gcccgagtca tggatctcct ccttctgctc gctgatgggc        60
     catgaattct tcgcagaggt gtcggaggac tttatcgagg atgacttcaa tcttacgggt       120
     ctgcagtcgc aggtgcccat gtacaaggag gcgctcgaga tgattctgga tgtggaaccg       180
     gaggaggacg aagatgagga ggaggaagaa gaggaagagg aggaggatga tgacgagatt       240
     ctcggtgatg agcgaccccc gggctaccgc agagctggcg accggagaca tgcgcgggtg       300
     gccagcgact tgagtgtgat cgaaagttct gcggagctgc tctacggcct catccaccag       360
     cgctacatca cgtcgcgacc gggaatccag cagatgctgg agaagtacga aatgcagcac       420
     tttggtgtct gtccgcgcac gtactgcaat ggaagcaagg tcttgcccgt gggctgctcc       480
     gacacgcctg ggcaagagac ggtgaagctg ttttgtccca gttgccagga tctgtacact       540
     ccgcccaaca gtcgttttca ctcggtcgat ggggccttct tcgggaccac gttcggatac       600
     cttttcttca tgacttttcc cgacctggac attgggcccc gcctggatcc ctccatgtta       660
     accgctgccc ctacgaatgc aaacaatcaa tctcgatctt cgtctctgac gtctggggtc       720
     aaccgcgcga ctcctgatct gccgccgccg ccgcctaacc agccaacaga gatcaacggc       780
     gtgcgaacgt ccaacttctg ccccggcctg ggaccaggta ggatttacga gtcgaagatt       840
     tacggatttc gcgtttcgga gcgatccaga gttggtccgc gcatgaagtg gctgcggatg       900
     aagccggcgg atatccggga gttggacgaa ttggctcagt acgaggccat ccacggttca       960
     gcgaacgatg gcggcgatac cgagatgaac attgaagctc agaatgcagc cgcaatcgca      1020
     gccaggaaga aagcgcccat gcggagacgg cggcatcatc ccgatcagat gagcatcaac      1080
     ggggcggaag gttga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page